SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026033 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026033
Domain Number 1 Region: 2-119
Classification Level Classification E-value
Superfamily POZ domain 3.93e-30
Family BTB/POZ domain 0.001
Further Details:      
 
Domain Number 2 Region: 352-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000228
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000026033
Domain Number - Region: 273-425
Classification Level Classification E-value
Superfamily FdhE-like 0.0641
Family FdhE-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026033   Gene: ENSMMUG00000019801   Transcript: ENSMMUT00000027827
Sequence length 498
Comment pep:known chromosome:MMUL_1:1:35232809:35252881:1 gene:ENSMMUG00000019801 transcript:ENSMMUT00000027827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEMQSYYAKLLGELNEQRKRDFFCDCSIIVEGRIFKAHRNILFANSGYFRALLIHYIQDS
GRHSTASLDIVTSDAFSIILDFLYSGKLDLCGENVIEVMSAASYLQMNDVVNFCKTYIRS
SLDICRKMEKEAAVAAAVAAAAAAAAAAAAAAAHQVDSGSPSSGREGTSCGTKSLVSSPA
VGEKSVDCLRESPCGDCGDCHPLELVVKDSLGGGSADSDLSTPPKRIEPKVEFDADEVEV
DVGEQLQQYAAPLNLAHVEEALPSGQTVDLAYSNYHVKQFLEALLRNSAAPSKDDADHHF
SRSLEGRPEGAGVAMSSMMDVQADWYGEDSGDVLVVPIKLHKCPFCPYTAKQKGILKRHI
RSHTGERPYPCETCGKRFTRQEHLRSHALSVHRSNRPIICKGCRRTFTSHLSQGLRRFGL
CDSCTCVTDTPDDDDDLMPINLSLMEASSESQEKSDTDNDWPIYVESEMGFHHVGQAGLK
LLTSSDLPASASQGAGIT
Download sequence
Identical sequences 9544.ENSMMUP00000026033 ENSMMUP00000026033 ENSMMUP00000026033

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]