SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026258 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026258
Domain Number 1 Region: 14-267
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.05e-47
Family FCH domain 0.0032
Further Details:      
 
Domain Number 2 Region: 435-497
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-24
Family SH3-domain 0.00063
Further Details:      
 
Domain Number 3 Region: 302-361
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000222
Family HR1 repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026258   Gene: ENSMMUG00000019968   Transcript: ENSMMUT00000028066
Sequence length 506
Comment pep:known chromosome:MMUL_1:12:32435058:32498294:1 gene:ENSMMUG00000019968 transcript:ENSMMUT00000028066 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRDPLTDCPYNKVYKNLKEFSQNGENFCKQVTSVLQQRANLEISYAKGLQKLASKLSKAL
QNTRKSCISSAWAWASEGMKSTADLHQKLGKAIELEAIKPTYQVLNVQEKKRKSLDNEVE
KTANLVISNWNQQIKAKKKLMVSTKKHEALFQLVESSKQSTTEKERRKLLNKLTKSTEKL
EKEDENYYQKNMVGYSTRLKWENTLENCYQSILELEKERIQLLCNNLNQYSQHISLFGQT
LTTCHTQIHCAISKIDIEKDIQAVMEETAILSTENKSEFLLTDYFEEDPNSAMDKERRKS
LIKPKLLRLQRDIEKASKDKEGLERMLKTYSSNSSFSDAKSQKDTAALMDENNLKLDLLE
ANSYKLSSVLAELEQRPQPSHPCSNSIFRWREKEHTHSYVKISRPFLMKRLESIVSKASS
GGQSNPSSSTPVPGAAQLSSRLCKALYSFQARQDDELNLEKGDIVIIHEKKEEGWWFGSL
NGKKGHFPAAYVEELPSNAGNTATKT
Download sequence
Identical sequences A0A1D5RA47 A0A2K5UZ64
XP_001103102.1.72884 XP_015287810.1.63531 ENSMMUP00000026258 ENSMMUP00000026258 ENSMMUP00000026259 9544.ENSMMUP00000026259

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]