SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026262 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026262
Domain Number 1 Region: 268-471
Classification Level Classification E-value
Superfamily Fibronectin type III 3.69e-40
Family Fibronectin type III 0.00000404
Further Details:      
 
Domain Number 2 Region: 880-1074
Classification Level Classification E-value
Superfamily Fibronectin type III 1.26e-38
Family Fibronectin type III 0.00000078
Further Details:      
 
Domain Number 3 Region: 671-878
Classification Level Classification E-value
Superfamily Fibronectin type III 2.73e-36
Family Fibronectin type III 0.0000033
Further Details:      
 
Domain Number 4 Region: 1402-1598
Classification Level Classification E-value
Superfamily Fibronectin type III 1.72e-33
Family Fibronectin type III 0.0026
Further Details:      
 
Domain Number 5 Region: 1077-1222
Classification Level Classification E-value
Superfamily Fibronectin type III 1.73e-30
Family Fibronectin type III 0.00073
Further Details:      
 
Domain Number 6 Region: 1235-1403
Classification Level Classification E-value
Superfamily Fibronectin type III 2e-30
Family Fibronectin type III 0.00079
Further Details:      
 
Domain Number 7 Region: 471-661
Classification Level Classification E-value
Superfamily Fibronectin type III 3.07e-22
Family Fibronectin type III 0.0000332
Further Details:      
 
Domain Number 8 Region: 80-171
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 9 Region: 176-274
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-18
Family I set domains 0.027
Further Details:      
 
Domain Number 10 Region: 5-77
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000285
Family I set domains 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026262   Gene: ENSMMUG00000019970   Transcript: ENSMMUT00000028070
Sequence length 1851
Comment pep:known chromosome:MMUL_1:16:68582917:68686416:-1 gene:ENSMMUG00000019970 transcript:ENSMMUT00000028070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVVDIPCRAKGVPPPSITWYKDAAVVEVEKLARFRQRSDGGLQISGLVPDDTGMFQCF
ARNAAGEVQTSTYLAVTSIAPNITRGPLDSTVIDGMSVVLACETSGAPRPAITWQKGERI
LASGSVQLPRFTPLESGSLLISPTHISDAGTYTCLATNSRGVDEASADLVVWARTRITKP
PQDQSVIKGTQASMVCGVSHDPRVTVRYIWEKDGATLGVESNPRIRLDRNGSLHISQTWS
GDIGTYTCRVISAGGNDSRSAHLRVRQLPHAPEHPVATLSTVERRAINLTWTKPFDGNSP
LLRYVLEMSENNAPWTILLASVDPKATSVTVKGLVPARSYQFRLCAVNDVGKGQFSKDTE
RVSLPEEPPTAPPQNVIASGRTNQSIMIQWQPPPESHQNGILKGYIIRWECLRGESLGIQ
FKNITDADVNNLLLEDLIIWTNYEIEVAAYNSAGLGVYSSKVTEWTLQGVPTVPPGNVHA
EATNSTTIRFTWNAPSPQFINGINQGYKLIAWEPEQEEEVTMVTARPNFQDSIHVGFVSG
LKKFTEYFTSVLCFTTPGDGPRSAPQLVRTHEDAPTSLGPIAPNVDLIASLVEKGELMPT
RGLSPGYRISWEEYNRTNTRVTHYLPNVTLEYRVTGLTALTTYTIEVAAMTSKGQGQVSA
STISSGVPPELPGPPTNLGISNIGPRSVTLQFRPGYDGKTSISRWLVEAQVGVVGEGEEW
LLIHQLSNEPDARSMEVPDLNPFTYYSFRMRQVNIVGTSPPSQPSRKIQTLQAPPDMAPA
NVSLRTASETSLWLRWMPLPEMEYNGNPESVGYKIKYSRSDGHGKTLSHVVQDRVEREYT
IEDLEEWTEYRVQVQAFNAIGSGPWSQTVVGRTRESVPSSGPTNVSALATTSSSMLVRWS
EVPEADRNGLVLGYKVIYKEKDSDAQPRFWLVEGNSSRSAQLTGLGKYVLYEVQVLAFTR
IGDGSPSHPPILERTLDDVPGPPMGILFPEVRTTSVRLIWQPPAAPNGIILAYQITHRLN
TTTANTATVEVLAPSARQYTATGLKPESVYLFRITAQTRKGWGDAAEALVVTTEKRDRPQ
PPSRPVVQQEDVRARSVLLSWEPGSDGLSPVRYYTIQTRELPSGRWTLHSASVSHNASSF
IVDRLKPFTSYKFRVKATNDIGDSEFSEESESLTTLQAAPDEAPTILSVTPHTTTSVLIR
WQPPAEDKINGILLGFRIRYRELLYEGLRGFTLRGINNPGATWAELTSMYSMRNLSRPSL
TQYELDNLNKHRRYEIRMSVYNAVGEGPSSTPQEVFVGEAVPTAAPRNVVVHGATATQLD
VTWEPPPLDSHNGDIQGYKIYFWEAQRGNLTERVKTLFLAENSVKLKNLTGYTAYMVSVA
AFNAAGDGPRSTPTQGQTQQAAPSAPSSVKFSELTTTSVNVSWEAPQFPNGILEGYRLVY
EPCSPVDGVSKIVTVDVKGNSPLWLKVKDLAEGVTYRFRIRAKTFTYGPEIEANVTTGPG
EGAPGPPGVPIIVRYSSAIAIHWSSGDPGKGPITRYVIEARPSDEGLWDILIKDIPKEVS
SYTFSMDILKPGVSYDFRVIAVNDYGFGTPSSPSQSVPAQKANPFYEEWWFLVVIALVGL
IFILLLVFVLIIRGQSKKYAKKTDSGNSAKSGALGHSEMMSLDESSFPALELNNRRLSVK
NSFCRKNGLYTRSPPRPSPGSLHYSDEDVTKYNDLIPAESSSLTEKPSEISDSQGSDSEY
EVDSNHQKAHSFVNHYISDPTYYNSWRRQQKGISRAQAYSYTESDSGEPDHATVTNSTST
QQGSLFRPKASRTPTPQNPPNPPSQQSTLYRPPSSLAPGSRAPIAGFSSFV
Download sequence
Identical sequences ENSMMUP00000026262 ENSMMUP00000026262 9544.ENSMMUP00000026262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]