SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026315 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026315
Domain Number 1 Region: 24-338
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-57
Family FCH domain 0.0021
Further Details:      
 
Domain Number 2 Region: 501-695
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.75e-55
Family BCR-homology GTPase activation domain (BH-domain) 0.000077
Further Details:      
 
Domain Number 3 Region: 745-807
Classification Level Classification E-value
Superfamily SH3-domain 5.34e-16
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026315   Gene: ENSMMUG00000020014   Transcript: ENSMMUT00000028127
Sequence length 1100
Comment pep:known chromosome:MMUL_1:2:51747351:52009160:1 gene:ENSMMUG00000020014 transcript:ENSMMUT00000028127 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSQTKFKKDKEIIAEYEAQIKEIRTQLVEQFKCLEQQSESRLQLLQDLQEFFRRKAEIE
LEYSRSLEKLAERFSSKIRSSREHQFKKDQYLLSPVNCWYLVLHQTRRESRDHATLNDIF
MNNVIVRLSQISEDVIRLFKKSKEIGLQMHEELLKVTNELYTVTEIVPLYSNLGNKSETL
KLKEAEKQEEKQFNKSGDLSMNLLRHEDRPQRRSSVKKIEKMKEKARAKYSENKLKCTKA
RNDYLLNLAATNAAISKYYIHDVSDLIDCCDLGFHASLARTFRTYLSAEYNLETSRHEGL
DVIENAVDNLDSRSDKHTVMDMCNQVFCPPLKFEFQPHMGDEVCQVSAQQPVQTELLMRY
HQLQSRLATLKIENEEVRKTLDATMQTLQDMLTVEDFDVSDAFQHSRSTESVKSAASETY
MSKINIAKRRANQQETEMFYFTKFKEYVNGSNLITKLQAKHDLLKQTLGEGERAECGTTR
PPCLPPKPQKMRRPRPLSVYSHKLFNGSMEAFIKDSGQAIPLVVESCIRYINLYGLQQQG
IFRVPGSQVEVNDIKNSFERGEDPLVDDQNERDINSVAGVLKLYFRGLENPLFPKERFQD
LISTIKLENPAERVHQIQQILVTLPRVVIVVMRYLFAFLNHLSQYSDENMMDPYNLAICF
GPTLMHIPDGQDPVSCQAHINEVIKTIIIHHEAIFPSPRELEGPVYEKCMAGGEEYCDSP
HSEPGTIDEVDHDNGTEPHTSDEEVEQIEAIAKFDYMGRSPRELSFKKGASLLLYHRASE
DWWEGRHNGVDGLIPHQYIVVQDMDDAFSDSLSQKADSEASSGPLLDDKASSKNDLQSPT
EHISDYGFGGVMGRVRLRSDGAAIPRRRSGGDTHSPPRGLGPSIDTPPRAAACPSSPHKI
PLTRGRIESPEKRRMATFGSAGSINYPDKKALSEGHSMRSTCGSTRHSSLGDHKSLEAEA
LAEDIEKTMSTALHELRELERQNTVKQAPDVVLDTLEPLKNPPGPISSEPASPLHTIVIR
DPDAAMRRSSSSSTEMMTTFKPALSARLAGAQLRPPPMRPVRPVVQHRSSSSSSSGVGSP
AVTPTEKMFPNSSADKSGTM
Download sequence
Identical sequences ENSMMUP00000026315 ENSMMUP00000026315 9544.ENSMMUP00000026315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]