SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000026837 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000026837
Domain Number 1 Region: 4-134
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.02e-44
Family Galectin (animal S-lectin) 0.000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000026837   Gene: ENSMMUG00000020396   Transcript: ENSMMUT00000028683
Sequence length 136
Comment pep:known chromosome:MMUL_1:19:45129236:45131660:1 gene:ENSMMUG00000020396 transcript:ENSMMUT00000028683 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHINLLCGEEQDSDAALHFNPRLDTSEV
VFNSKEQGSWGREERGPGVPFQRGQPFEVLIIASDDGFKAVVGDAQYHHFRHRLPLARVR
LVEVGGDVQLDSVKIF
Download sequence
Identical sequences F6U8V6
9544.ENSMMUP00000026837 ENSMMUP00000026837 ENSMMUP00000026837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]