SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027624 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027624
Domain Number 1 Region: 680-737
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 5.56e-17
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 3-45
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000262
Family Somatomedin B domain 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027624   Gene: ENSMMUG00000020994   Transcript: ENSMMUT00000029521
Sequence length 779
Comment pep:known scaffold:MMUL_1:1099548049568:598316:603855:1 gene:ENSMMUG00000020994 transcript:ENSMMUT00000029521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DAQDSCSMRCGALDGPCSCHPTCSGLGTCCLDFRDFCLEILPYSGSMMGGKDFVVQHFKM
SSPTDTSAICRFKESIQTLGHVDSSGQVHCVSPLLYESGRVPFTVSLDNGHSFPRAGTWL
AVHPNKVSMMEKSELVNETRWQYYGTADTSGNLSLTWHVEALPTQTVTIELWGYEETGMP
YSQEWTAKWSYLYPLATNIPNSGSFTFTPKPAPPSYQRWRVGALRIIDSKNYAGQKDVQA
LWTNDHALAWHLSNDFREDPVAWARTQVSSPATRGFGLPSPPPHSCGETEGKPWAFTPLP
ALARGLGGPTSGLHTHQGAHIIPTWSKAKRPGWGDMSYGASREPSGGNSPGNVHRWPAQS
QSCAPVAPSVLKSHCKVASPARLRMPLASANEKIPGWDGWGPGRGLSALRVQGPSGRAQA
GVAAAAKARGTHTCISAWGVHRRGCTSGATGGSWSAELALGTPSLPLQVPSPTAPGCQPP
CPGAAGGQNMVSTAGDPDPSHLCPGMFLSVAARDTVSIMLASGAGLEVSVQGPFLSVSVL
LPEKFLTHTHGLLGTLNNDPTDDFTLRSGRVLPPGSSPRELFLFGADWAVHNASSLLTYD
SWFLVHNFLYQPKHDPTFEPLFAGETTLNPSQAQEAAKLCGDDHFCNFDVAATGSLSTGN
ATRVAHQLHQHRMRSLQPVVSCGWLAPPPNGQKEGNRYLAGSTIYFHCDNGYSLAGAETS
TCQADGTWSSPTPECQPGRSYAVLLGIIFGGLSVVAAVALVYVLLRHRKGNMHIWGTQP
Download sequence
Identical sequences 9544.ENSMMUP00000027624 ENSMMUP00000027624 ENSMMUP00000027624

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]