SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027667 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027667
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily EF-hand 3.64e-48
Family Calmodulin-like 0.00000054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027667   Gene: ENSMMUG00000021025   Transcript: ENSMMUT00000029566
Sequence length 160
Comment pep:known chromosome:MMUL_1:10:18672262:18676331:1 gene:ENSMMUG00000021025 transcript:ENSMMUT00000029566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAII
EEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPEELAEIF
RASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ
Download sequence
Identical sequences A0A096NX35 A0A2J8XVI4 A0A2K5NFI7 A0A2K5WJR8 A0A2K6AG58 A0A2K6D3V3 F7HGA7 G1R4X9 G3SHW7 H2R8W5 P02585
NP_001253479.1.72884 NP_003270.1.87134 NP_003270.1.92137 XP_001157246.1.37143 XP_003253703.1.23891 XP_003826032.1.60992 XP_004062330.1.27298 XP_005569235.1.63531 XP_011765184.1.29376 XP_011839185.1.47321 XP_011921227.1.92194 ENSNLEP00000008251 ENSP00000361636 ENSPTRP00000052087 ENSPTRP00000052087 9544.ENSMMUP00000027667 9598.ENSPTRP00000052087 9606.ENSP00000361636 ENSP00000361636 ENSNLEP00000008251 gi|4507617|ref|NP_003270.1| ENSMMUP00000027667 ENSGGOP00000027707 ENSP00000361638 ENSGGOP00000027707 ENSMMUP00000027667

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]