SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000027872 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000027872
Domain Number 1 Region: 2688-2976
Classification Level Classification E-value
Superfamily BEACH domain 2.62e-126
Family BEACH domain 0.0000000151
Further Details:      
 
Domain Number 2 Region: 3047-3246,3409-3441
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.86e-31
Family WD40-repeat 0.0011
Further Details:      
 
Domain Number 3 Region: 2534-2656
Classification Level Classification E-value
Superfamily PH domain-like 1.11e-22
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Domain Number 4 Region: 3449-3517
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 7.2e-20
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0015
Further Details:      
 
Domain Number 5 Region: 1091-1286
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000591
Family Trypanosoma sialidase, C-terminal domain 0.072
Further Details:      
 
Domain Number 6 Region: 470-514,580-658,852-913
Classification Level Classification E-value
Superfamily ARM repeat 0.00000151
Family Armadillo repeat 0.06
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000027872
Domain Number - Region: 1410-1461,1513-1579,1614-1704
Classification Level Classification E-value
Superfamily ARM repeat 0.000158
Family HspBP1 domain 0.073
Further Details:      
 
Domain Number - Region: 2345-2405
Classification Level Classification E-value
Superfamily Cyclin-like 0.0018
Family Retinoblastoma tumor suppressor domains 0.014
Further Details:      
 
Domain Number - Region: 117-391
Classification Level Classification E-value
Superfamily ARM repeat 0.0249
Family Armadillo repeat 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000027872   Gene: ENSMMUG00000021164   Transcript: ENSMMUT00000029780
Sequence length 3526
Comment pep:known chromosome:MMUL_1:5:44665077:44852263:1 gene:ENSMMUG00000021164 transcript:ENSMMUT00000029780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNMVKRIMGRPRQEECSPQDNALGLMHLRRLFTELCHPPRHMTQKEQEEKLYMMLPVFNR
VFGNAPPNTMTEKFSDLLQFTTQVSRLMVTEIRRRASNKSTEAASRAIVQFLEINQSEEA
SRGWMLLTTINLLASSGQKTVDCMTTMSVPSTLVKCLYLFFDLPHVPEAVGGAQNELPLA
ERRGLLQKVFVQILVKLCSFVSPAEELAQKDDLQLLFSAITSWCPPYNLPWRKSAGEVLM
TISRHGLSVNVVKYIHEKECLSTCVQNMQQSDDLSPLEIVEMFAGLSCFLKDSSDVSQTL
LDDFRIWQGYNFLCDLLLRLEQAKEAESKDALKDLVNLITSLTTYGVNELKPAGITTGAP
FLLPGFAVPQPAGKGHSVRNIQAFAVLQNAFLKAKTSFLAQIILDAITNIYMADNANYFI
LESQHTLSQFAEKISKLPEVQNKYFEMLEFVVFSLNYIPCKELISVSILLKSSSSYHCSI
IAMKTLLKFTRHDYIFKDVFREVGLLEVMVNLLHKYAALLKDPTQAQNEQGDSRNNSSVT
KQAFRMILIFDVRTPLLDFFSFLQGIFREFGGARCAHNIVKYPQCRQHALMTIQQLVLSP
NGDDDMGTLLGLMHSAPPTELQLKTDILRALLSVLRESHRSRTVFRKVGGFVYITSLLVA
MERSLSCPPKNGWEKVNQNQVFELLHTVFCTLTAAMRYEPANSHFFKTEIQYEKLADAVR
FLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVVSIESVSPTLRHCSKLFIYLYKVATDSF
DSRAEQIPPCLTSESSLPSPWGTPALSRKRHVYHSVSTPPVYPPKNVADLKLHVATSSLQ
TSDAVIIHPGAMLAMLDLLASVGSVTQPEHALDLQLAVANILQSLVHTERNQQVMCEAGL
HARLLQRCSAALADEDHSLHPPLQRMFERLASQALEPMVLREFLRLASPLNCGAWDKKLL
KQYRVHKPSSLSYEPEMRSSMITSLEGLGTDNVFSLHEDNHYRISKSLVKSAEGSTVPLT
RVKCLVSMTTPHDIRLHGSSVTPAFVEFDTSLEGFGCLFLPSLAPHNAPTTNTVTTGLID
GAVVSGIGSGERFFPPPSGLSYSSWFCIEHFSSPPNNHPVRLLTVVRRANSSEQHYVCLA
IVLSAKDRSLIVSTKEELLQNYVDDFSEESSFYEILPCCARFRCGELIIEGQWHHLVLVM
SKGMLKNSTAALYIDGQLVNTVKLHYVHSTPGGSGSANPPVVSTVYAYIGTPPAQRQIAS
LVWRLGPTHFLEEVLPSSNVTTIYELGPNYVGSFQAVCMPCKDAKSEGVVPSPVSLVPEE
KVSFGLYALSVSSLTVARIRKVYNKLDSKAIAKQLGISSHENATPVKLIHNSAGHLNGSA
RTIGAALIGYLGVRTFVPKPVATTLQYIGGAAAILGLVAMASDVEGLYAAVKALVCVVKS
NPLASKEMERIKGYQLLAMLLKKKRSLLNSHILHLTFSLVGTVDSGHETSIIPNSTAFQD
LLCDFEVWLHAPYELHLSLFEHFIELLTESSEASKNAKLMREFQLIPKLLLTLRDMSLSQ
PTIAAISNVLSFLLQGFPNSNDLLRFGQFISSTLPTFAVCEKFVVMEINNEEKLDTGTEE
EFGGLVSANLILLRNRLLDILLKLIYTSKEKTSINLQACEELVKTLGFDWIMMFMEEHLH
STTVTAAMRILVVLLSNQSILIKFKEGLSGGGWLEQTDSVLTNKIGTVLGFNVGRSAGGR
STVREINRDACHFPGFPVLQSFLPKHTNVPALYFLLMALFLQQPVSELPENLQVSVPVIS
CRSKQGCQFDLDSIWTFIFGVPASSGTVVSSIHNVCTEAVFLLLGMLRSMLNSPWQSEEE
GSWLREYPVTLMQFFRYLYHNVPDLASMWMSPDFLCALAATVFPFNIRPYSEMVTDLDDE
VGSPAEEFKAFAADTGMNRSQSEYCNVGTKTYLTNHPAKKFVFDFMRVLIIDNLCLTPAS
KQTPLIDLLLEASPERSTRTQQKEFQTYILDSVMDHLLAADVLLGEDASLPITSGGSYQV
LVNNVFYFTQRVVDKLWQGMFNKESKLLIDFIIQLIAQSKRRSQGLSLDAVYHCLNRTIL
YQFSRAHKTVPQQVALLDSLRVLTVNRNLILGPGNHDQEFISCLAHCLINLHVGSNVDGF
GLEAEARMTTWHIMIPSDIEPDGSYSQDISEGRQLLIKAVNRVWTELIHSKKQVLEELFK
VTLPVNERGHVDIATARPLIEEAALKCWQNHLAHEKKCISRGEALVPTTQSKLSRVSSGF
GLSKLTGSRRNRKESGLNKHSLSTQEISQWMFTHIAVVRDLVDTQYKEYQERQQNALKYV
TEEWCQIECELLRERGLWGPPIGSHLDKWMLEMTEGPCRMRKKMVRNDMFYNHYPYVPET
EQETNVASEIPSKQPETPDDIPQKKPARYRRAVSYDSKEYYMRLASGNPAIVQDTIVESS
EGEAAQQEPEHGEDTIAKVRGLVKPPLKRSRSAPDGGDEENQEQLQDQIAEGSSIEEEEK
TDNATLLRLLEEGEKIQHMYRCARVQGLDTSEGLLLFGKEHFYVIDGFTMTATREIRDIE
TLPPNMHEPIIPRGARQGPSQLKRTCSIFAYEDIKEVHKRRYLLQPIAVEVFSGDGRNYL
LAFQKGIRNKVYQRFLAVVPSLTDSSESVSGQRPNTSVEQGSGLLSTLVGEKSVTQRWER
GEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEEVDLTNPKTFRNLAKPMGAQT
DERLAQYKKRYKDWEDPNGETPAYHYGTHYSSAMIVASYLVRMEPFTQIFLRLQGGHFDL
ADRMFHSVREAWYSASKHNMADVKELIPEFFYLPEFLFNSNNFDLGCKQNGTKLGDVILP
PWAKGDPREFIRVHREALECDYVSAHLHEWIDLIFGYKQQGPAAVEAVNVFHHLFYEGQV
DIYNINDPLKETATIGFINNFGQIPKQLFKKPHPPKRVRSRLNGDNAGISVLPGSTSDKI
FFHHLDNLRPSLTPVKELKEPVGQIVCTDKGILAVEQNKVLIPPTWNKSFAWGYADLSCR
LGTYESDKAVTVYECLSEWGQILCAICPNPKLVITGGTSTVVCVWEMGTSKEKAKTLTLK
QALLGHTDTVTCATASLAYHIIVSGSRDRTCIIWDLNKLSFLTQLRGHRAPVSALCINEL
TGDIVSCAGTYIHVWSINGNPIVSVNTFTGRSQQIICCCVSEMNEWDTQNVIVTGHSDGV
VRFWRMEFLQVPETPAPEPAEHLEMQEDCPEAQIGQEGQDEDSSDSEADEQSVSQDPKDT
PSQPSSTSHRPRTASCRAAAAWCTDSGSDDSRRWSDQLSLDEKDGFIFVNYSEGQTRAHL
QGPLSHPHPNPIEVRNYSRLKPGYRWERQLVFRSKLTMHTAFDRKDNAHPAEVTALGISK
DHSRILVGDSRGRVFSWSVSDQPGRSAADHWVKDEGGDSCSGCSVRFSLTERRHHCRNCG
QLFCQKCSRFQSEIKRLKISSPVRVCQNCYYNLQHERGSEDGPRNC
Download sequence
Identical sequences 9544.ENSMMUP00000027872 ENSMMUP00000027872 ENSMMUP00000027872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]