SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028148 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028148
Domain Number 1 Region: 342-402
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 1.76e-17
Family Erythroid transcription factor GATA-1 0.00014
Further Details:      
 
Domain Number 2 Region: 287-340
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.5e-16
Family Erythroid transcription factor GATA-1 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028148   Gene: ENSMMUG00000021371   Transcript: ENSMMUT00000030078
Sequence length 480
Comment pep:known chromosome:MMUL_1:11:86349789:86364081:1 gene:ENSMMUG00000021371 transcript:ENSMMUT00000030078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVAPEQPRWMAHPAVLNAQHPDSHHPGLAHNYMEPAQLLPPDEVDVFFNHLDSQGNPYY
ANPAHARARVSYSPAHARLTGGQMCRPHLLHSPGLPWLDGGKAALSAAAAHHHNPWTVSP
FSKTPLHPSAAGGPGGPLSVYPGAGGGSGGGSGSSVASLTPTAAHSGSHLFGFPPTPPKE
VSPDPSTTGAASPGSSSAGGSAARGEDKDGVKYQVSLTESMKMESGSPLRPGLATMGTQP
ATHHPIPTYPSYVPAAAHDYSSGLFHPGGFLGGPASSFTPKQRSKARSCSEGRECVNCGA
TATPLWRRDGTGHYLCNACGLYHKMNGQNRPLIKPKRRLSAARRAGTCCANCQTTTTTLW
RRNANGDPVCNACGLYYKLHNVNRPLTMKKEGIQTRNRKMSNKSKKSKKGAECFEELSKC
MQEKSSPFSAAALAGHMAPVGHLPPFSHSGHILPTPTPIHPSSSLSFGHPHPSSMVTAMG
Download sequence
Identical sequences A0A2K5JLI7 A0A2K5KWR3 A0A2K5WN29 A0A2K6A373 A0A2K6BE94 A0A2K6RED9
ENSMMUP00000028148 9544.ENSMMUP00000028148 ENSMMUP00000028148 XP_005571824.1.63531 XP_010352905.1.97406 XP_010352912.1.97406 XP_011732885.1.29376 XP_011806109.1.43180 XP_011806110.1.43180 XP_011826692.1.47321 XP_011826693.1.47321 XP_011826694.1.47321 XP_011915762.1.92194 XP_011915763.1.92194 XP_014985584.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]