SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028391 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028391
Domain Number 1 Region: 2-45
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000106
Family Calponin-homology domain, CH-domain 0.001
Further Details:      
 
Domain Number 2 Region: 182-211
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000143
Family LIM domain 0.0086
Further Details:      
 
Domain Number 3 Region: 151-181
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000187
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028391   Gene: ENSMMUG00000021558   Transcript: ENSMMUT00000030338
Sequence length 853
Comment pep:known chromosome:MMUL_1:10:81838314:81875254:1 gene:ENSMMUG00000021558 transcript:ENSMMUT00000030338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XWCRRQCEGYRGVEIRDLSSSFRDGLAFCAILHRHRPDLLGLDRVAKRELVPRHKEIGPE
RGSKELKITQQTNSTAGLESLHPAIFSFIIYIYKMKFSLCRPGWTGVSPPRKGLAPCSPP
SVAPTSAEPEDVAQGEELSSGSLSEQATGQTPSSTCAACQQHVHLVQRYLADGRLYHRHC
FRCRRCSSTLLPGAYENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAED
AKDVPGGSPSSSAPAGAEADGPKASPEARPQIPTKPRVPGKPQELASTPAGRPTPAPRKA
SESIAPAPPTPRPRSSLQQENLVEQAGSSSLVNGRLHEPPVPKPRGTPKLSEGTPAPRKD
PPWITLVQAEPKKKPAPLPPSSSPGPPSQDSRQVENGGTEEVAQPSPAASLEPKPYNPFE
EEEEDEEEEAPAAPSLATSPALGHLESTPKSLHPWYGITPTSSPKTKKRPAPRAPSASPL
ASQAGHRSISSPSLSCSLNVLSIGVLSAARGSRKGGVCLNPNSVTVAAVPERPGLSPGRA
LSVAAGPSPSSAYPLTQARWSFWPSPSPIPWDPRTHGALGAQRRLACLGGEPQVHLLVGN
PCPTPSPGSLLPLLGNKSSCKENPFNRKPSPAASPVTKKATKGSKPVRPPAPGHGFPLIK
RKVQADQYIPEEDIHGEMDTIERRLDALEHRGVLLEEKLRGGLNEGREDDMLVDWFKLIH
EKHLLVRRESELIYVFKQQNLEQRQADVEYELRCLLNKPEKDWTEEDRAREKVLMQELVT
LIEQRNAIVNCLDEDRQREEEEDKMLEAMIKKKEFQREAEPEGKKKGKFKTMKMLKLLGN
KRDAKSKSPRDKS
Download sequence
Identical sequences ENSMMUP00000028391 9544.ENSMMUP00000028391 ENSMMUP00000028391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]