SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000028808 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000028808
Domain Number 1 Region: 212-310
Classification Level Classification E-value
Superfamily Immunoglobulin 3.13e-28
Family I set domains 0.00056
Further Details:      
 
Domain Number 2 Region: 16-110
Classification Level Classification E-value
Superfamily Immunoglobulin 5.33e-26
Family I set domains 0.0003
Further Details:      
 
Domain Number 3 Region: 113-209
Classification Level Classification E-value
Superfamily Immunoglobulin 3.82e-23
Family I set domains 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000028808   Gene: ENSMMUG00000021881   Transcript: ENSMMUT00000030781
Sequence length 332
Comment pep:known chromosome:MMUL_1:19:60842580:60844490:1 gene:ENSMMUG00000021881 transcript:ENSMMUT00000030781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GQGRSVDSSLWFLPGILPKPSLWAEPGSVISWGSSVTLWCQGTLDTQGYHLTKEGSTMTW
HQQSPPEPRNKTNFFIPSMREHYAGTYRCHYLSSAGWSELSDPLELVVTGVSRKPSLLTL
QGPVVAPGETLTLQCRSDVGYDRFALYKEQGHDLLQRSGRQPQAGLSQANFTLGPVRVSH
GGQYRCYGAHNLSSEWSAPSDPLDILIAGQIPDRPFLSVQPGPTVASGKNMTLLCQSRSP
MDTFLLTKEGAAHHLLRLRSEHRAQQHQAEFPMGPVTSAHAGTYRCYSSHRFFPYLLSHP
SDPLELVVSGEGPDLVLSELKGSAQALPPAEL
Download sequence
Identical sequences ENSMMUP00000028808 9544.ENSMMUP00000028808 ENSMMUP00000028808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]