SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029285 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029285
Domain Number 1 Region: 10-91
Classification Level Classification E-value
Superfamily PDZ domain-like 4.73e-20
Family PDZ domain 0.0000762
Further Details:      
 
Domain Number 2 Region: 505-569
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.83e-17
Family LIM domain 0.023
Further Details:      
 
Domain Number 3 Region: 446-508
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.17e-16
Family LIM domain 0.0019
Further Details:      
 
Domain Number 4 Region: 413-444
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000419
Family LIM domain 0.0012
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000029285
Domain Number - Region: 564-592
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00159
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029285   Gene: ENSMMUG00000022246   Transcript: ENSMMUT00000031294
Sequence length 596
Comment pep:known chromosome:MMUL_1:5:87425753:87558181:1 gene:ENSMMUG00000022246 transcript:ENSMMUT00000031294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNYSVSLVGPAPWGFRLQGGKDFNMPLTISSLKDGGKASQANVRIGDVVLSIDGISAQG
MTHLEAQNKIKGCTGSLNMTLQRASATPKPEPVPVQKGEPKEVVKPVPITSPAVSKVTST
NNMAYNKAPRPFGSVSSPKVTSIPSPSSAFTPAHATTSSHASPSPVAAVTPPPFAASGLH
ANANLSADQSPSALSAGKTAVNVPRQPTVTSVCSETSQELAEGQRRGSQGDSKQQNGPPR
KHIVERNTEFYHIPTHSDASKKRLIEDTEDWRPRTGTTQSRSFRILAQITGTEHLKESEA
DNTKKANNSQEPSPQLTSSVASTRSMPESLDSPASGRPGVASLTTAAAFKPVGSTGVIKS
PSWQRPNQAVPSTGRISNSATSSGSVAPASSALGQPQPSAQDTLVQRAEHIPAGKRTPMC
AQCNQVIRGPFLVALGKSWHPEEFNCAHCKNTMAYVGFVEEKGALYCELCYEKFFAPECG
RCQRKILGEVINALKQTWHVSCFVCVACGKPIRNNVFHLEDGEPYCETDYYALFGTICHG
CEFPIEAGDMFLEALGYTWHDTCFVCSVCCESLEGQTFFSKKDKPLCKKHAHSVNF
Download sequence
Identical sequences A0A1D5R093
XP_001103447.1.72884 ENSMMUP00000029285 9544.ENSMMUP00000029288 ENSMMUP00000029288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]