SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029649 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029649
Domain Number 1 Region: 779-848
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 6.67e-25
Family VHP, Villin headpiece domain 0.0000961
Further Details:      
 
Domain Number 2 Region: 252-315
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.3e-17
Family LIM domain 0.0035
Further Details:      
 
Domain Number 3 Region: 125-188
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.78e-16
Family LIM domain 0.0023
Further Details:      
 
Domain Number 4 Region: 182-218
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000045
Family LIM domain 0.0015
Further Details:      
 
Domain Number 5 Region: 311-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000143
Family LIM domain 0.0021
Further Details:      
 
Domain Number 6 Region: 224-251
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000323
Family LIM domain 0.01
Further Details:      
 
Domain Number 7 Region: 87-123
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000654
Family LIM domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029649   Gene: ENSMMUG00000022524   Transcript: ENSMMUT00000031691
Sequence length 848
Comment pep:known chromosome:MMUL_1:9:114089145:114143316:-1 gene:ENSMMUG00000022524 transcript:ENSMMUT00000031691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAFLGLKCLGKLCSSEKSKVTSSERTSARGSNRKRLIVEDLRVSGTSFPAHRRATVTHL
LYLCPEDYCPHGRVCNSVDPFVAHPQDPHHPSEKPVIHCHKCGEPCKGEVLRVQTKHFHI
KCFTCKVCGCDLAQGGFFIKNGEYLCTLDYQRMYGTRCHGCGEFVEGEVVTALGKTYHPN
CFACTICKRPFPPGDRVTFNGRDCLCQLCAQPMSSSPKETTFSSNCAGCGRDIKNGQALL
ALDKQWHLGCFKCKSCGKVLTGEYISKDGAPYCEKDYQGLFGVKCEACHQFITGKVLEAG
DKHYHPSCARCSRCNQMFTEGEEMYLQGSTVWHPDCKQSTKTEEKLRLPNIRRSSSDFFY
PKSLIRRTGRSPSLQPTRTSSESIYSRPGSSIPGSPGHTIYAKVDNEILDYKDLAAIPKV
KAIYDIERPDLITYEPFYTSGYDDKQERQSLGEVIHSSGCELCLEGYQDVRDRMIHRSTS
QGSISSPVYSRHSYTPTTSRSPQHFHRPELLSPGVQRLSYLRTSSLSPTHSDSRPNPPFR
HHFIPHIKGNEPSSGRNSPLPYRPDSRPLTPTYAQAPKHFHVPDQGINIYRKPPIYKQHA
ALAAQSKSSEEIIKFSKFPAAQAPDPSETPKIETDHWPGPPSFAAVGPDMRRRSSGREED
DEELLRRRQLQEEQLMKLNSGLGQLILKEEMEKESRERSSLLASRYDSPINSASYIPSSK
TASLPGYGRNGLHRPVSTDFAQYNSYGDVSGGVRESNTLPDGHMPAMRMDRGVSMPNMLE
PKAKIFPYEMLMVTNRGRNKILREVDRTRLERHLAPEVFREIFGMSIQEFDKLPLWRRND
MKKKAKLF
Download sequence
Identical sequences ENSMMUP00000029649 9544.ENSMMUP00000029655 ENSMMUP00000029655

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]