SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029674 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000029674
Domain Number - Region: 365-475
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0112
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029674   Gene: ENSMMUG00000022539   Transcript: ENSMMUT00000031718
Sequence length 585
Comment pep:known chromosome:MMUL_1:2:99407992:99498319:1 gene:ENSMMUG00000022539 transcript:ENSMMUT00000031718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTPGSGRKRTPVKDRFSAEDEALSNIAREAEARLAAKRAARAEARDIRMRELERQQKEH
SHHSFDRKWGQIQKWLEDSERARYSHRSSHHRPYLGVEDALSIRSLGSHRYDMFKDRSSR
LSSLNHSYSHSHGMKKKSSGSHKDLLSGLYFDQRNYSSLRHSKPTSAYYTRQSSSLYSDP
LATYKSDRASSTANSGLLRSASLASLYNGGLYNPYGSRTPSECSYYSSRTSSARSSPVFT
NDDTASIVSSDRASRGQRESVVSAADYFSRSNRRGSVVSEVDDISIPDLSSLDEKSDKQY
AENYTRPSSRNSASATTPLSGNSSRRGSGDTSSLIDPDTSLSELRDIYDLKDQIQDVEGR
YMQGLKELKESLSEVEEKYKKAMVSNAQLDNEKNNLIYQVDTLKDVIEEQEEQMAEFYRE
NEEKSKELERQKHMCSVLQHKMEELKEGLRQRDELIEEKQRMQQKIDTMTKEVFDLQETL
LWKDKKIGALEKQKEYIACLRNERDMLREELADLQETVKTGEKHGLVIIPDGTPNGDVSH
EPVAGAITVVSQEAAQVLESAGEGPLDVRLRKLAGEKEELLSQVK
Download sequence
Identical sequences 9544.ENSMMUP00000029674 ENSMMUP00000029674 ENSMMUP00000029674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]