SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000029773 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000029773
Domain Number 1 Region: 624-671
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000901
Family Ovomucoid domain III-like 0.0072
Further Details:      
 
Domain Number 2 Region: 713-753
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000166
Family Ovomucoid domain III-like 0.019
Further Details:      
 
Domain Number 3 Region: 757-788
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000416
Family Ovomucoid domain III-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000029773   Gene: ENSMMUG00000022613   Transcript: ENSMMUT00000031822
Sequence length 971
Comment pep:known chromosome:MMUL_1:15:41345795:41432724:-1 gene:ENSMMUG00000022613 transcript:ENSMMUT00000031822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVRVSLRGALLLLLAVAGVAEVAGGLAPGSAGALCCNHSKDNQMCRDVCEQIFSSKSE
SRLKHLLQRAPDYCPETMVEIWSCMNSSLPGVFKKSDGWVGLGCCELAIALECRQACKQA
SSKNDISKVCRKEYENALFSCISRNEMGSVCCSYAGHHTNCREYCQAIFRTDSSPGPSQI
KAVENYCASISPQLIHCVNNYTQSYPMRNPTDSLYCCDRAEDHACQNACKRILMSKKTEM
EIVDGLIEGCKTQPLPQDPLWQCFLESSQSVHPGVTVHPPPSTGLDGAKLHCCSKANTST
CRELCTKLYSMSWGNTQSWQEFDRFCEYNPVEVSMLTCLADVREPCQLGCRNLTYCTNFN
NRPTELFRSCNAQSDQGAMNDMKLWEKGSIKMPFINIPVLDIKKCQPEMWKAIACSLQIK
PCHSKSRGSIICKSDCVEILKKCGDQNKFPEDHTAESICELLSPTDDLKNCIPLDTYLRP
STLGNIVEEVTHPCNPNPCPANELCEVNRKGCPSGDPCLPYSCVQGCKLGEASDFIVRQG
TLIQVPSSAGEVGCYKICSCGQSGLLENCMEMHCIDLQKSCIVGGKRKSHGTSFSIDCNV
CSCFAGNLVCSTRLCLSEHSSEDDRRTFTGLPCNCADQFVPVCGQNGRTYPSACIARCVG
LQDHQFEFGSCMSKDPCNPNPCQKNQRCIPKPQVCLTTFDKFGCSQYECVPRQLTCDQIQ
DPVCDTDHMEHNNLCTLYQRGKSLSYKGPCQPFCRATEPVCGHNGETYSSVCAAYSDRVA
VDYYGDCQAVGVLSEHSSVAECASVKCPSLSAAGCKPIIPPGACCPLCAGMLRVLFDKEK
LDTIAKVTNKKPITVLEILQKIRMHVSVPQCDVFGYFSIESEIVILIVPVDHYPKALQIE
ACNKEAEKIESLINSDSPTLASHVPLSALIISQVQVSSSVPSAGVRARPSYHSFLLPLSL
GLALHLFWTYN
Download sequence
Identical sequences ENSMMUP00000029773 9544.ENSMMUP00000029773 XP_001083599.1.72884 XP_005581387.1.63531 ENSMMUP00000029773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]