SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030028 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030028
Domain Number 1 Region: 152-217
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-19
Family SH3-domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030028   Gene: ENSMMUG00000022802   Transcript: ENSMMUT00000032093
Sequence length 733
Comment pep:known chromosome:MMUL_1:13:109843670:109911661:-1 gene:ENSMMUG00000022802 transcript:ENSMMUT00000032093 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARRQRDPLQALRRRNQELKQQVDNLLSESQLKEEALEPNKRQDIYQRCIQLKQAIDEN
KNALQKLSKADESAPVANYNQRKEEEHTLLDKLTQQLQGLAVTISRKNITEVGAPTEQEE
ESESEESEDSGEEEEDTEEEEEEKEENEYHKPSTGEEYIAVGDFTAQQAGDLTFKKGEIL
LVIEKKPDGWWIAKDAKGNEGLVPRTYLEPYSEEEEEGQESIEEGSEEDVEVVDETADGA
EVKQRTDSHWSAVQKAISEVGIFCLINDVLFCYLIALMRNRMETVEDSNGSETGFRTWNV
QSRGCIFLSVKAIQINTVDVLTTMGAIPAGFRPSTLSQLLEEGNQFRASYFLQPELMPSQ
LAFRDLMWDATEGTIRSRPSRISLILTLWSCKMIPLPGMSIQVLSRHVRLCLFDGNKVLS
NIHTVRATWQSKKPKTWTFSPQVSRILPCLLDGDCFIRSNSASPDVGILFELGISYIRNS
TGERGELSCGWVFLKLFDASGVPIPAKTYELFLNGGTPYEKGVDVDPSVSRRAHGSVFYQ
MMAMRRQPQLLVKLRSLNRRSRNVLSLLPETLIGSMCSVHLLIFYRQILGDVLLKDRMSL
QSTDLISHPMLATFPMLLEQPDVMDALRSSWAEKESMLKRSEKRDKEFLKSTFLLVYHDC
VLPLLHSTRLPPFRWAEEESETARWKVITDFLKQNQENQGALQALLSPDGIHEPFDLSEQ
TYDFLGEMRKNAV
Download sequence
Identical sequences 9544.ENSMMUP00000030028 ENSMMUP00000030028 ENSMMUP00000030028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]