SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030134 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030134
Domain Number 1 Region: 8-71
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000288
Family HLH, helix-loop-helix DNA-binding domain 0.0052
Further Details:      
 
Domain Number 2 Region: 80-123
Classification Level Classification E-value
Superfamily Orange domain-like 0.0000209
Family Hairy Orange domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030134   Gene: ENSMMUG00000022882   Transcript: ENSMMUT00000032210
Sequence length 173
Comment pep:known chromosome:MMUL_1:1:9432507:9433447:-1 gene:ENSMMUG00000022882 transcript:ENSMMUT00000032210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGRENSNCSKLEKADVL
EMTVRFLQELPALSWPTAAPVPCDSYREGYSACVARLARVLPACRVLEPAVSARLLEHLW
RRAASATLDGGRAGDSGGPSAPAPTPASAPQPASVPVPSPPSPPCGPGLWRPW
Download sequence
Identical sequences A0A1D5R8B9 A0A2K5UY12
9544.ENSMMUP00000030134 XP_001092640.1.72884 XP_005544981.1.63531 ENSMMUP00000030134 ENSMMUP00000030134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]