SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030152 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030152
Domain Number 1 Region: 1271-1462
Classification Level Classification E-value
Superfamily vWA-like 1.11e-43
Family Integrin A (or I) domain 0.0000000124
Further Details:      
 
Domain Number 2 Region: 1648-1870
Classification Level Classification E-value
Superfamily vWA-like 3.59e-39
Family Integrin A (or I) domain 0.0000000414
Further Details:      
 
Domain Number 3 Region: 648-709
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.00000000000343
Family BSTI 0.086
Further Details:      
 
Domain Number 4 Region: 294-348
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000000409
Family BSTI 0.047
Further Details:      
 
Domain Number 5 Region: 773-829
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000213
Family ATI-like 0.014
Further Details:      
 
Domain Number 6 Region: 2195-2251
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.000000507
Family ATI-like 0.066
Further Details:      
 
Domain Number 7 Region: 1471-1528
Classification Level Classification E-value
Superfamily vWA-like 0.000000871
Family Integrin A (or I) domain 0.011
Further Details:      
 
Domain Number 8 Region: 827-895
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000199
Family VWC domain 0.029
Further Details:      
 
Domain Number 9 Region: 1143-1196
Classification Level Classification E-value
Superfamily Serine protease inhibitors 0.0000229
Family ATI-like 0.03
Further Details:      
 
Domain Number 10 Region: 2572-2647
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000377
Family VWC domain 0.045
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000030152
Domain Number - Region: 2420-2496
Classification Level Classification E-value
Superfamily FnI-like domain 0.000178
Family VWC domain 0.073
Further Details:      
 
Domain Number - Region: 348-387
Classification Level Classification E-value
Superfamily FnI-like domain 0.00293
Family VWC domain 0.063
Further Details:      
 
Domain Number - Region: 699-740
Classification Level Classification E-value
Superfamily FnI-like domain 0.00555
Family VWC domain 0.034
Further Details:      
 
Domain Number - Region: 440-512
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 0.0122
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030152   Gene: ENSMMUG00000022893   Transcript: ENSMMUT00000032228
Sequence length 2810
Comment pep:known chromosome:MMUL_1:11:6063482:6236625:-1 gene:ENSMMUG00000022893 transcript:ENSMMUT00000032228 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIPARLAGVLLALALVLPGTLCAEGTRGRSSMARCSLFGSDFINTFDGSMYSFAGYCSYL
LAGDCQKRSFSIIGDFQNGKRVSLSVYLGEFFDIHLFVNGTVTQGDKSVSMPYASKGLYL
ETEAGYYKLSGEAYGFVARIDGSGNFQVLLSDRYFNKTCGLCGNFNIFAEDDFMTQEGTV
TSDPYDFANSWALSSGEQWCERASPPSSSCNISSGEVQKGLWEQCQLLKSTSVFARCHPL
VDPEPFVALCEKTSCECAGGLECTCPAFLEYTRTCAQEGMVLYGWTDHSACSPVCPAGME
YKQCVSPCARTCQSLHINEVCQERCVDGCSCPEGQLLDEGLCVESTECPCMHSGKRYPPG
ASLSRDCNTCICRNSQWICSNEECPGECLVTGQSHFKSFDNRYFTFSGICQYLLARDCED
HSFSIVIETVQCADDPDAVCTRSVTVRLPGLHNSLVKLKHGGGVAMDGQDVQLPLLKGDL
RIQHSVTASVRLSYGEDLQMDWDGRGRLLVKLSPVYAGKTCGLCGNYNGNQGDDFLTPSG
LAEPRVEDFGNAWKLHADCQDLQKQHSDPCALNPRMTRFSEEACAVLTSPTFEACHRAVS
PLPYLRNCRYDVCSCSDGRECLCGALASYAAACAGRGVRVAWREPGRCELKCPKGQVYLQ
CGTPCNLTCRALSYPDEECNEACLEGCFCPPGLYMDEMGDCVPKAQCPCYYDGEIFQPED
IFSDHHTMCYCEDGFMHCTMSGVPGSLLPDAVLSSPLSHRSKRSLSCRPPMVKLVCPADN
PRAEGLECAKTCQNYDLECMSMGCVSGCLCPPGMVRHENRCVALERCPCLHQGKEYAPGE
AVKIDCNTCVCRDRKWNCTDHVCDATCSTIGMAHYLTFDGLKYMFPGECQYVLVQDYCGG
NPGTFRILVGNEGCSHPSVKCKKHVTILVEGGEIELFDGEVNVKRPMKDETHFEVVESGR
YIILLLGKAISVVWDRHLSISVVLKQTYQEKVCGLCGNFDGIQNNDLTSSNLQVEEDPVD
FGNSWKVSSQCADTRKVPLDSSPATCHNNLMKQTMVDSSCRILTSDVFQDCNKLVDPEPF
LDVCIYDTCSCESIGDCACFCDTIAAYAHVCAQHGKVVTWRTATLCPQSCEERNLRENGY
ECEWRYNSCAPACRVTCQHPEPLPCPVQCVEGCHAHCPPGKILDELLQTCVSPEDCPVCE
AAGRRFASGKKVTLNPSDPEHCQICHCDGVNLTCEACEEPGGLVVPPTDAPVSPTTPYVE
DISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVLKAFVVDMMERLRISQKWVRVAVVE
YHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVASTSEVLKYTLFQIFGKIDRPEASRI
ALLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGIGPHANLKQIHLIEKQSPENKAFVL
SGVDELEQQRDEIVSYLCDLAPEAPPPTLSPDMAQVTVGPGLLGVSTLGPKRNSMVLDVA
FVLEGSDKIGEADFNRSKEFMEEELERIGWPNAPILIQDFETLPREAPDLGGVRKGAEDP
HPLPCPWYAGTLAGRGLAWPWCCMHLPRYDSGSNPGFPALCALVKKTSLSLSHSLFPTQF
HPLPSRARPGSQVPVLNLFAYHGSPLLLRKPRELHLSHPLLPGPRCPCTHEGTPPPLVVP
RDCSQPLDVILLLDGSSSFPAAYFDEMKSFAKAFISKANIGPHLTQVSVLQYGSITTIDV
PWNVAPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVMDV
SVDAVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGNSNVVKLQRIEDLPTMVTL
GNSFLHKLCSGFVRICMDEDGNERRPGDIWTLPDQCHTVTCQPDGQTLLESHRVNCDRGL
RPSCPNSQSPVKVEETCGCRWTCPCVCTGSSTRHIVTFDGQNFKLTGSCSYVLFQNKEQD
LEVILHNGACSPAARQGCMKSIEVKHAALSVELHSDMEVTVNGRLVSVPYVGGNMEVNVY
GAIMHEVRFNHLGHIFTFTPQNNEFQLQLSPKTFASKTYGLCGICDENGANDFMLRDGTV
TTDWKTLVQEWTVQRPGQTCQPILEEQCLVPNSSQCQVLLSALFAECHKVLAPATFYAIC
QQDSCHREQVCEVIASYAHLCRTNGVCVDWRTPDFCAMSCPPSLVYNPCERGCPRHCNGN
VSSCGDHPSEGCFCPPNKVMLEGSCVPEEACTQCIGEDGVQHQFLEAWVPDHQPCQICTC
LSGRKANCTMQPCPTAKAPTCGLCEVARLRQNADQCCPEYECVCDPESCDLPPVPRCEGG
LQPTLTNPGECRPNFTCACRKEECKRVSPPSCPPHRLPTLRKTQCCDEYECACNCVNSTV
SCPLGYLASTATNDCGCTTTTCLPDKVCVHRSTIYPVGQFWEEGCDVCTCTDMEDAVMGL
RVVQCSQKPCEDSCRSGFTYVPREGECCGRCLPSACEVVTGSPRGDSQSSWKSVGSHWAS
PENPCLINECVRVKEEVFVQQRNVSCPQLEVPVCPSGFQLSCKTSACCPSCRCEPVEACM
LNGTMIGPGKSVMIDACTTCRCIVQVGIISGFKLECRKTICNPCPLGYKEENNTGECCGR
CLPTVCTIRLRGGQIMTLKRDETLQDGCDTHFCKVNERGEYFWEKRVTGCPPFDEHKCLA
EGGKIMKIPGTCCDTCEEPECSDITARLQYVKVGSCKSEVEVDIHYCQGKCASKAMYSID
INDVQDQCSCCSPTRTEPMQVPLHCTNGSVVYHEVLNAMQCECSPRKCSK
Download sequence
Identical sequences ENSMMUP00000030152 ENSMMUP00000030152 9544.ENSMMUP00000030152

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]