SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030178 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030178
Domain Number 1 Region: 16-144
Classification Level Classification E-value
Superfamily NTF2-like 9.64e-28
Family NTF2-like 0.01
Further Details:      
 
Domain Number 2 Region: 333-438
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000597
Family Canonical RBD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030178   Gene: ENSMMUG00000022912   Transcript: ENSMMUT00000032254
Sequence length 461
Comment pep:known scaffold:MMUL_1:1099214501650:229:1662:-1 gene:ENSMMUG00000022912 transcript:ENSMMUT00000032254 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLSAAQVELTKAMVMEKPTPLLVGWKFVRQHYALVNQALDMLHRFYGKNSSHVHGGLDSN
GKPADAVFQKEIHRKVTSQNFTNCHTKILHVDAYAMLNNGVVVQVMVLLSNNNQALRRFM
QMFVLAPEGSIAYQFYVHNDILRHQDGFVTEPQEESEEEVEEPEERQQSPDSGTFYDQAI
VSNDMEEHLEEPVAELEPDPEPEPEQEHVSEIQEEKFELVLEETAPEDAQKSSLAPADIS
EDLRTFSWASVTSNNLPPSGAVPVTGIPPHVCKVLASQPCTESKPESQVPPQRPQRDQRI
REQQINIPPQKGPRAICEAGEQGDIEPRRMVRHPDSHQLFIGNLLHKVDKSELKDFFQNY
GNMVELHNSGGKLPNFDFVVFDDSEPVQKVLSNRSIMFRGEVRLIVEEKKTSAREGDPRD
DRLCGPGGPLGGLGGGMRGPPCGGMVQKAGFGMGRWLAPRQ
Download sequence
Identical sequences ENSMMUP00000030178 9544.ENSMMUP00000030178 ENSMMUP00000030178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]