SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030492 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030492
Domain Number 1 Region: 158-487
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 9.38e-62
Family Polypeptide N-acetylgalactosaminyltransferase 1, N-terminal domain 0.0000000227
Further Details:      
 
Domain Number 2 Region: 489-619
Classification Level Classification E-value
Superfamily Ricin B-like lectins 5.54e-31
Family Ricin B-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030492   Gene: ENSMMUG00000023165   Transcript: ENSMMUT00000032585
Sequence length 619
Comment pep:known chromosome:MMUL_1:11:48503716:48528677:-1 gene:ENSMMUG00000023165 transcript:ENSMMUT00000032585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLLRRHHTPLRLAIVGCTFVFFLFLLHRDVSNREEATEKPWLKSLVSRKDHVLDIMLEA
MNNLRDSMPKLQIRAPEAQPTLFSINQSCLPGFYTPAELKPFWERPPQDPNAPGADGKAF
QKSKWTPLETQEKEEGYKKHCFNAFASDRISLQRSLGPDTRPPECVDQKFRRCPPLATTS
VIIVFHNEAWSTLLRTVYSVLHTTPAILLKEIILVDDASTEEHLKEKLEQYVKQLQVVKV
VRQEERKGLITARLLGASVAQAEVLTFLDAHCECFHGWLEPLLARIAEDKTVVVSPDIVT
IDLNTFEFAKPVQRGRVHSRGNFDWSLTFGWETLPPHEKQRRKDETYPIKSPTFAGGLFS
ISKSYFEHIGTYDNQMEIWGGENVEMSFRVWQCGGQLEIIPCSVVGHVFRTKSPHTFPKG
TSVIARNQVRLAEVWMDSYKKIFYRRNLQAAKMAQEKSFGDISERLQLREQLHCHSFSWY
LHNVYPEMFVPDLTPTFYGAIKNLGTNQCLDVGENNRGGKPLIMYSCHGLGGNQYFEYTT
QRDLRHNIAKQLCLHVSKGALGLGSCHFTGKNSQVPKDEEWELTQDQLIRNSGSGTCLTS
QDKKPAMAPCNPNDPHQLW
Download sequence
Identical sequences 9544.ENSMMUP00000030492 ENSMMUP00000030492 ENSMMUP00000030492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]