SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000030565 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000030565
Domain Number 1 Region: 388-612
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-34
Family Calponin-homology domain, CH-domain 0.00039
Further Details:      
 
Domain Number 2 Region: 85-242,380-462
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.99e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.061
Further Details:      
 
Domain Number 3 Region: 723-754
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000523
Family LIM domain 0.00055
Further Details:      
 
Domain Number 4 Region: 689-722
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000108
Family LIM domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000030565   Gene: ENSMMUG00000023221   Transcript: ENSMMUT00000032665
Sequence length 1066
Comment pep:known chromosome:MMUL_1:4:154454944:154465285:1 gene:ENSMMUG00000023221 transcript:ENSMMUT00000032665 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASPTSTNPAHAHFESFLQAQLCQDVLSSFQELCGALGLEPGGGLPQYHKIKDQLNYWSA
KSLWTKLDKRAGQPVYQQGRACTSTKCLVVGAGPCGLRVAVELALLGARVVLVEKRTKFS
RHNVLHLWPFTIHDLRALGAKKFYGRFCTGTLDHISIRQLQLLLLKVVLLLGVEIHWGVT
FTGLQPPPRKGNGWRAQLQPNPPAQLANYEFDVLISAAGGKFVPEGFKVREMRGKLAIGI
TANFVNGRTVEETQVPEISGVARIYNQSFFQSLLKATGIDLENIVYYKDDTHYFVMTAKK
QCLLRLGVLRQDWPDTDRLLGSANVVPEALQRFARAAADFATHGKLGKLEFAQDAHRQPD
VSAFDFTSMLRAESSARVQEKHGARLLLGLVGDCLVEPFWPLGTGVARGFLAAFDAAWMV
KRWAEGAEPLEVLAERESLYQLLSQTSPENMHRNVAQYGLDPATRYPNLNLRAVTPNQVR
DLYDVLTKEPVQRNDKTDAGMPTTGGSAGTQEELLRWCQEQTAGYPGVHVSDLSSSWTDG
LALCALVHRLQPGLLEPSELQGLGALEATAWALKVAEHELGITPVVSAQAVVAGSDPLGL
IAYLSHFHSAFKSTAHSPGPVSQASPGTSSAVLFLGKLQRTLQRSRAKENAEDAGGKKLR
LEMDAETPSTEVPPDPEPGVPLTPPSQHQEAGAGDLCALCGEHLYVLERLCVDGHFFHRS
CFRCHTCEATLWPGGYEQHPGDGHFYCLQHLPQPDHKEEGSDGGPESPELPTPSENSMPP
GLSTPTASQEGVGPVPDPSQPTRRRIHLSSLERQRLSSLNLTPDPEMEPPPKPPRSCSAL
ARHALESSFVGWGLPVQGPQALVAMEKEEEESSSSSEEEEDVPLDSDVEQALQTFAKTSG
TMNDYPTWRRTLLRRAKEEEMKRFRKAQTIQRRLNEIEGALRELEAEGVKLELALRRQSS
SPEQQKKLWVGQLLQLVDKKNSLVAEEAELMITVQELNLEEKQWQLDQELRGYMNREETL
KTAADRQAEDQVLRKLVDLVNQRDALIRLQEERRLSELALGIGAQG
Download sequence
Identical sequences ENSMMUP00000030565 ENSMMUP00000030565 9544.ENSMMUP00000030565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]