SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031191 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031191
Domain Number 1 Region: 434-530
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.42e-25
Family SPRY domain 0.00084
Further Details:      
 
Domain Number 2 Region: 6-80
Classification Level Classification E-value
Superfamily RING/U-box 1.04e-20
Family RING finger domain, C3HC4 0.0076
Further Details:      
 
Domain Number 3 Region: 304-376
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-19
Family SPRY domain 0.0027
Further Details:      
 
Domain Number 4 Region: 96-157
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000000000000336
Family B-box zinc-binding domain 0.0014
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000031191
Domain Number - Region: 382-423
Classification Level Classification E-value
Superfamily ARM repeat 0.000265
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031191   Gene: ENSMMUG00000023679   Transcript: ENSMMUT00000033327
Sequence length 537
Comment pep:known chromosome:MMUL_1:4:29774306:29789408:-1 gene:ENSMMUG00000023679 transcript:ENSMMUT00000033327 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSAPLRSLEEEVTCSICLDYLRDPVTIDCGHVFCRSCTTDVRPISGSRPVCPLCKKPF
KKENIRPVWQLASLVENIERLKVDKGRQPGEVTREQQDAKLCERHREKLHYYCEDDGKLL
CVMCRESREHRPHTAVLMEKAAQPHREKILNHLSTLRRDRDKIQGFQAKGEADILAALEA
LRWCTRVGQGEPGQAGGSWEVSLALFVGRTGVSLAVADLGFSPECHLHKKRTTFVLFTDM
SHLCYSVGCKCIEDTRDFLNRYPRKKFWVGKPIARVVKKKTGEFSDKLLSLQRGLREFQG
KLLRDLEYKTVSVTLDPQSASGYLQLSEDWKCVTYTSLYKSAYLHPQQFDCEPGVLGSKG
FTWGKVYWEVEVEREGWSEDEEDGDEEEEGEEEEEEEEAGYGDGYDDWETDEDEESLGDE
EEEEEEEEEEVLESCMVGVARDSMKRKGDLSLRPEDGVWALRLSSSGIWANTSPEAELFP
ALRPRRVGIALDYEGGTVTFTNAESQELIYTFTATFTRRLVPFLWLKWPGTRLLLRP
Download sequence
Identical sequences 9544.ENSMMUP00000031191 ENSMMUP00000031191 ENSMMUP00000031191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]