SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031282 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031282
Domain Number 1 Region: 1933-2213
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.14e-77
Family Protein kinases, catalytic subunit 0.000000233
Further Details:      
 
Domain Number 2 Region: 100-280
Classification Level Classification E-value
Superfamily Fibronectin type III 9.38e-25
Family Fibronectin type III 0.0031
Further Details:      
 
Domain Number 3 Region: 1656-1846
Classification Level Classification E-value
Superfamily Fibronectin type III 4.79e-22
Family Fibronectin type III 0.0036
Further Details:      
 
Domain Number 4 Region: 960-1149
Classification Level Classification E-value
Superfamily Fibronectin type III 1.25e-19
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 5 Region: 677-901
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000000000419
Family YWTD domain 0.0024
Further Details:      
 
Domain Number 6 Region: 1154-1418
Classification Level Classification E-value
Superfamily YWTD domain 0.000000000000119
Family YWTD domain 0.0092
Further Details:      
 
Domain Number 7 Region: 556-676
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000249
Family Fibronectin type III 0.0078
Further Details:      
 
Domain Number 8 Region: 1480-1640
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000352
Family Fibronectin type III 0.0054
Further Details:      
 
Domain Number 9 Region: 294-514
Classification Level Classification E-value
Superfamily YWTD domain 0.00000000536
Family YWTD domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031282   Gene: ENSMMUG00000023738   Transcript: ENSMMUT00000033424
Sequence length 2345
Comment pep:known chromosome:MMUL_1:4:146568358:146710185:1 gene:ENSMMUG00000023738 transcript:ENSMMUT00000033424 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKNIYCLIPKLVNFATLGCLWISVVQCTVLNSCLKSCVTNLGQQLDLGTPHNLSEPCIQG
CHFWNSVDQKNCALKCRESCEVGCSSAEGAYEEEVLGNADLPTAPFASSIGSHNMTLRWK
SANFSGVKYIIQWKYAQLLGSWTYTKTVSKLSYVVEPLHPFTEYIFRVVWIFTAQLQLYS
PPSPSYRTHPHGVPETAPLIRNIESSSPDTVEVSWDPPQFPGGPILGYNLRLISKNQKLD
AGTQRTSFQFYSTLPNTMYRFSTAAVNEVGEGPEAESSITTSSSAVQEEEQWLFLSRKTS
LRKRSLKHLVDEAHCLRLDAIYHNITGISVDVHQQIVYFSEGTLIWAKKAVNMSDVSDLK
IFYRGSGLISSISVDWLYQRMYFIMDELVCVCDLENCSNIEEITPPSISAPRKIVADSYN
GYVFYLLRDGIYRADLPVPSGRCAETVRIVESCTLKDFAIKPQSKRIIYFNDTAQVFMST
FLDGSASHLILPRIPFADVKSFACENNDFLVTDGKVIFQQDALSFNEFIVGCDLSHIEEF
GFGNLVIFGSSSQPHPLPGRPQELSVLFGSHQAFVQWKPPALAIGANVILTSDIIELFEL
GPSAWQNWTYEVKVSTQDPPEVTRIFSNISGTRLNVPELQSAMKYKVSVRASSPKRPGPW
TEPSVGTTLVPASEPPFIMAVKEDGLWSKPLNSFGPGEFLSSDIGNVSDMDWYNNSLYYS
DTKGDVFVWQLNGMDISENYHLPGIAGAGALAFEWLGHFLYWAGKTYVIQRQSVLTGHTD
IVTHVKLLVNDMVVDSVGGYLYWTTLYSVESTRLNGESSLILQAQPWFSGKKVIALTLDL
SDGLLYWLVQDSQCIHLYTAVLRGQSTGDTTITEFAAWSTSEISQNALMYYSGRLFWING
FRIITTQEIGQRTSVSVLEPAKFNQFTIIQTSLKPLPGNFSFTPKVIPDSVQESSFRIEG
NASSFQILWNGPPAVDWGVVFYSVEFSAHSKFLASAQHSLPVFTVEGLEPYALFNLSVTP
YTYWGKGPKTALSLRAPETVPSAPENPRIFILPSGKCCNKNEVVVEFRWNKPKHENGVLT
KFEIFYKISNQSITNKTFEDWIAVDVTPSVMSFQLEDMSPRCFVAFQVRAFTSKGPGSFA
DVVKSTTSEINPFPHLITLLGNEIVFLDMDQNQVVWTFSAERVISAICYTADNELGYYAE
GDSLFLLNLHNRSSSELFRDSLVFDITVITIDWISRHLYFALKESQNGMQIFDVDLEHKV
KYPREVKIHNRNSTIISFSVYPLLSRLYWTEVSSFGYQMFYYSIINCTLHRILQPTATNQ
QNKRNQCSCNVTEFELSGAMAIDTSNLEKPLIYFTKAQEIWAMDLEGCHCWRVITVPAML
GKTLASLTVDGDFIYWIITAKDSTRIYQAKKGNGAIVSQVKALRSRHILAYSSVMQPFPD
KAFLSLASDTVEPTILNATNTSLTIRLPLAKTTLTWYGITSPTPTYLVCYAEVNDRKNSS
DLKYRILEFQDSIALIEDLQPFSTYMIQIAVKNYYSDPLEHLPPGKEIWGKTKNGVPEAV
QLINTTVRSDTSLIISWRESHKPNGPKESVRYQLAISHLAPIPETPLRQSEFPNGRLTLL
VTRLSGGNIYVLKVLACHSEEMWCTESHPVTVEMFNAPEKPYSLVPENTSLQFNWKAPSN
VNLIRFWAELQKWKYNEFYHVKTSCSQGPAYVCNITNLQPHTSYNVRVVVVYKTGENSTS
LPESFKTKAGVPGKPGIPKLLEGSKNSIQWEKAEDNGCRIIYYILEIRKSTSNLQNQNLR
WKMTFNGSCSSICTWKSKNLKGIFQFRVVAANNLGFGEYSGISENTILVGDDFWIPETSF
ILSIIVGIFLVITIPLTFVWHRRLKNQKSAKEGLTVLLNEDKELAELRGLAAGVGLANAC
YAIHTLPTQEEIENLPAFPREKLTLRLLLGSGAFGEVYEGTAVDILGAGSGEIKVAVKTL
KKGSTDQEKIEFLKEAHLMSKFNHPNILKQLGVCLLNEPQYIILELMEGGDLLTYLRKAR
MATFYGPLLTLVDLVDLCVDISKGCVYLEQMHFIHRDLAARNCLVSVKDYTSPRIVKIGD
FGLARDIYKNDYYRKRGEGLLPVRWMAPESLMDGIFTTQSDVWSFGILIWEILTLGHQPY
PAHSNLDVLNYVQTGGRLEPPRNCPDDLWNLMTQCWAQEPDQRPTFHRIQDQLQLFRNFF
LNSIYQCRDEANTSGVINENFEGEDGDVICLNSDDIMPVALMETKNREGLNYMVLATECS
QGEEKSEGPLGSQESKSCGLRKEEKEPHADKDFCQEKQVAYCPPGKPEGLNYACLSHTGY
GDGAD
Download sequence
Identical sequences ENSMMUP00000031282 ENSMMUP00000031282 9544.ENSMMUP00000031282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]