SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031294 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031294
Domain Number 1 Region: 660-852
Classification Level Classification E-value
Superfamily Fibronectin type III 3.15e-41
Family Fibronectin type III 0.0000018
Further Details:      
 
Domain Number 2 Region: 371-563
Classification Level Classification E-value
Superfamily Fibronectin type III 3.36e-40
Family Fibronectin type III 0.00000243
Further Details:      
 
Domain Number 3 Region: 873-1046
Classification Level Classification E-value
Superfamily Fibronectin type III 9.58e-38
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 554-657
Classification Level Classification E-value
Superfamily Fibronectin type III 1.03e-21
Family Fibronectin type III 0.000000649
Further Details:      
 
Domain Number 5 Region: 267-381
Classification Level Classification E-value
Superfamily Fibronectin type III 1.16e-17
Family Fibronectin type III 0.000000585
Further Details:      
 
Domain Number 6 Region: 1038-1145
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000122
Family Fibronectin type III 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031294   Gene: ENSMMUG00000023756   Transcript: ENSMMUT00000033436
Sequence length 1197
Comment pep:known chromosome:MMUL_1:17:27944184:28024430:1 gene:ENSMMUG00000023756 transcript:ENSMMUT00000033436 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEHPPLLDTTQILSSDISLLSAPIVSADGTQQVILVQVNPGEAFTIRREDGQFQCITGK
NVCMPMNSPLSPLPPVTHPPWPPKVIEDNGVRRVVVVPQAPEFHPGGHTVLHRSPHPPLP
GFIPVPTMMPPPPRHMYSPVTGAGDMTTQYMPQYQSSQVYGDVDAHSTHGRSNFRDERSS
KTYERLQKKLKDRQGTQKDKMSSPPSSPQKCPSPINEHNGLIKGQNAGGINTGSAKIKSG
KGKGVVQVDTEIEEKNEETKAFEALLSNIVKPVASDIQARTVVLTWSPPSSLINGETDES
TVPELYGYEVLISSTGKDGKYKSVYVGEETNITLNDLKPATDYHAKVQAEYNSIKGTPSE
AEIFTTLSCEPDIPNPPRIANRTKNSLTLQWKAPSDNGSKIQNFVLEWDEGKGNGKCQCY
MGSQKQFKITKLSPAMGCKFRLSARNDYGTSGFSEEVLYYTSGCAPSMPASPVLTKAGIT
WLSLQWSKPSGTPSDEGISYILEMEEETSGYGFKPKYDGEDLAYTVKNLRRSTKYKFKVI
AYNSEGKSNPSEVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGAAINKYVV
EMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAVP
PGPCLPPRLQGRPKAKEIQLRWGPPLVDGGSPISCYSVEMSPIEKDEPREVYQGSEVECT
VSSLLPGKTYSFRLRAANKMGFGPFSEKCDITTAPGPPDQCKPPQVTCKSATCAQVNWEV
PLSNGTDVTEYRLEWGGVEGSMQICYCGPGLNYEIKGLSPATTYYCRVQALSVVGAGPFS
EVVACVTPPSVPGIVTCLQEISDDEIENPHYSPSTCLAISWEKPCDHGSEILSYSIDFGD
KQSLTVGKVTSYIINNLQPDTTYRIRIQALNSLGAGPFSHMIKLKTKPLPPDPPRLECVA
FSHQNLKLKWGEGTPKTLSADSIQYHLQMEDKNGRFVSLYRGPCHTYKVQRLNESTSYKF
CIQACNEAGEGPLSQEYIFTTPKSVPPALKAPKIEKVNDHICEITWECLQPMKGDPVIYS
LQVMLGKDSEFKQIYKGPDSSFRYSSLQLNCEYRFRVCAIRQCQDSLGHQDLVGPYSTTV
LFISQRTEPPASTNRDTVESTRTRRALSDEQCAAVILVLFAFFSILIAFIIQYFVIK
Download sequence
Identical sequences ENSMMUP00000036303 ENSMMUP00000031294 9544.ENSMMUP00000036303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]