SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031622 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031622
Domain Number 1 Region: 11-157
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.3e-47
Family Galectin (animal S-lectin) 0.00013
Further Details:      
 
Domain Number 2 Region: 192-324
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.21e-46
Family Galectin (animal S-lectin) 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031622   Gene: ENSMMUG00000028766   Transcript: ENSMMUT00000038521
Sequence length 324
Comment pep:known chromosome:MMUL_1:19:45144615:45155169:-1 gene:ENSMMUG00000028766 transcript:ENSMMUT00000038521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFVPAPGYQPTYNPTLPYYKPIPGGLSVGMSVYIQGVANEHMRRFFVNFAVGQDPGADI
AFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFLVLAEHYKVVVNGNS
FYEYGHRLPLQMVTHLQVDGDLQLQSINFIGGQLPPPQGPPMMPPYPGPGHCHQQLNSLP
VKWDPPILFLQPVPYFGRLQGGLTARRTIIIKGYVPPTGKSFAINFKVGSTGDIALHINP
RMGDGTVVRNSLLKGSWGSEERKITHNPFGPGQFFDLSIRCGLDRFKVFANGQHLFDFAH
RFLAFQRVDTVEIQGDVTLSYVQI
Download sequence
Identical sequences 9544.ENSMMUP00000031622 ENSMMUP00000031622 ENSMMUP00000031622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]