SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000031761 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000031761
Domain Number 1 Region: 122-390
Classification Level Classification E-value
Superfamily Nuclear receptor ligand-binding domain 9.31e-64
Family Nuclear receptor ligand-binding domain 0.00000706
Further Details:      
 
Domain Number 2 Region: 54-134
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.44e-31
Family Nuclear receptor 0.0000793
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000031761   Gene: ENSMMUG00000028849   Transcript: ENSMMUT00000038675
Sequence length 404
Comment pep:known chromosome:MMUL_1:19:16784110:16799054:-1 gene:ENSMMUG00000028849 transcript:ENSMMUT00000038675 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMVTGGWGGPGGDTNGVDKAGGYPRAAEDDSASPTGAASDAEPGDEERPGLQVDCVVCG
DKSSGKHYGVFTCEGCKSFFKRSIRRNLSYTCRSNRDCQIDQHHRNQCQYCRLKKCFRVG
MRKEAVQRGRIPHSLPGAVATSSGSPPGSALAAVGGGGDLFPGQPVSELIAQLLRAEPYP
AAAGRFGAGGGAAGAVLGIDNVCELAARLLFSTVEWARHAPFFPELPVADQVALLRLSWS
ELFVLNAAQAALPLHTAPLLAAAGLHAAPMAAERAVAFMDQVRAFQEQVDKLGRLQVDSA
EYGCLKAIALFTQDACGLSDPAHVESLQEKAQVALTEYVRAQYPSQPQRFGRLLLRLPAL
RAVPASLISQLFFMRLVGKTPIETLIRDMLLSGSTFNWPYGSGQ
Download sequence
Identical sequences ENSMMUP00000031761 ENSMMUP00000031761 9544.ENSMMUP00000031761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]