SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032020 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032020
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-19
Family Glutathione peroxidase-like 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032020   Gene: ENSMMUG00000028946   Transcript: ENSMMUT00000038932
Sequence length 69
Comment pep:known chromosome:MMUL_1:19:818096:857522:1 gene:ENSMMUG00000028946 transcript:ENSMMUT00000038932 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLV
IEKDLPHYF
Download sequence
Identical sequences Q2PG26 Q6PJX4
9544.ENSMMUP00000032020 ENSMMUP00000032020 ENSMMUP00000032020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]