SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000032708 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000032708
Domain Number 1 Region: 17-84
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000155
Family Glutathione S-transferase (GST), N-terminal domain 0.0000446
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000032708   Gene: ENSMMUG00000015699   Transcript: ENSMMUT00000039644
Sequence length 88
Comment pep:known scaffold:MMUL_1:1099214319177:516:975:1 gene:ENSMMUG00000015699 transcript:ENSMMUT00000039644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PWVGVAFQAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLL
FLLYGTEVHTDTKQIEEILEAVLCPSQY
Download sequence
Identical sequences ENSMMUP00000032708 9544.ENSMMUP00000032708 ENSMMUP00000032708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]