SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033140 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033140
Domain Number 1 Region: 84-161
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000249
Family HLH, helix-loop-helix DNA-binding domain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033140   Gene: ENSMMUG00000029441   Transcript: ENSMMUT00000040069
Sequence length 273
Comment pep:known chromosome:MMUL_1:4:126349421:126351640:1 gene:ENSMMUG00000029441 transcript:ENSMMUT00000040069 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSDSSSVSSRASSPDMDEMYLRDHHHRHHHHHQESRLNSVSSTQGDMMQKMSGESLSRA
GAKAAGESSKYKIKKQLSEQDLQQLRLKINGRERKRMHDLNLAMDGLREVMPYAHGPSVR
KLSKIATLLLARNYILMLTSSLEEMKRLVGEIYGGHHSAFHCGTVGHSAGHPAHAANAVH
PVHPILGGALSSGNASSPLSAASLPAIGTIRPPHSLLKAPSTPPALQLGSGFQHWAGLPC
PCTICQMPPPPHLSALSTANMARLSAESKDLLK
Download sequence
Identical sequences A0A2K5KUY8 A0A2K5UKR4 F7GMY4
9544.ENSMMUP00000033140 ENSMMUP00000033140 ENSMMUP00000033140 XP_001096569.1.72884 XP_011946924.1.92194 XP_015304202.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]