SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033757 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033757
Domain Number 1 Region: 750-915
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.06e-34
Family MAM domain 0.00068
Further Details:      
 
Domain Number 2 Region: 238-329
Classification Level Classification E-value
Superfamily Immunoglobulin 6.06e-17
Family I set domains 0.0051
Further Details:      
 
Domain Number 3 Region: 343-442
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000488
Family I set domains 0.043
Further Details:      
 
Domain Number 4 Region: 438-540
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000573
Family I set domains 0.036
Further Details:      
 
Domain Number 5 Region: 535-631
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000891
Family I set domains 0.032
Further Details:      
 
Domain Number 6 Region: 48-132
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000012
Family I set domains 0.069
Further Details:      
 
Domain Number 7 Region: 131-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000839
Family I set domains 0.03
Further Details:      
 
Domain Number 8 Region: 194-240,632-740
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000714
Family Fibronectin type III 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033757   Gene: ENSMMUG00000003725   Transcript: ENSMMUT00000040725
Sequence length 972
Comment pep:known chromosome:MMUL_1:4:37419085:37476888:-1 gene:ENSMMUG00000003725 transcript:ENSMMUT00000040725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEVTCLLLLALIPFHCRGQGVYAPAQAQIVHAGQACVVKEDNISERVYTIREGDTLMLQC
LVTGHPRPQVRWTKTAGSASDKFQETSVFNETLRIERIARTQGGRYYCKAENGVGVPAIK
SIRVDVQYLDEPMLTVHQTVSDVRGNFYQEKTVFLRCTVNSNPPARFIWKRGSDTLSHSQ
DNGVDIYEPLYTQGETKVLKLKNLRPQDYASYTCQVSVRNVCGIPDKAITFRLTNTTAPP
ALKLSVNETLVVNPGENVTVQCLLTGGDPLPQLQWSHGPGPLPLGALAQGGTLSIPSVQA
RDSGYYNCTATNNVGNPAKKTVNLLVRSMKNATFQITPDVIKESENIQLGQDLKLSCHVD
AVPQEKVTYQWFKNGKPARMSKRLLVTRNDPELPAVTSSLELIDLHFSDYGTYLCMASFP
GAPVPDLSVEVNISSETVPPTISVPKGRAVVTVREGSPAELQCEVRGKPRPPVLWSRVDK
EAALMPSGLPLEETPDGKLRLERVSRDMSGTYRCQTARYNGFNVRPREAQVQLNVQFPPE
VEPSSQDVRQALGRPVLLRCSLLRGSPQRIASAVWRFKGQLLPPPPVVPAAAEAPDHAEL
RLDAVTRDSSGSYECSVSNDVGSAVCLFQVSAKAYSPEFYFDTPNPTRSHKLSKNYSYVL
QWTQREPDAVDPVLNYRLSVRQLNQHNAVVKAIPVRRVEKGQLLEYILTDLRVPHSYEVR
LTPYTTFGAGDMASRIIHYTEPINSPNLSDNTCHFEDEKICGYTQDLTDNFDWTRQNALT
QNPKRSPNTGPPTDISGTPEGYYMFIETSRPRELGDRARLVSPLYNASAKFYCVSFFYHM
YGKHIGELGDQVVSTKCALTSRGWALERLTGGTHPGFHRAQAPVGNFQIIFEGVRGSGYL
GDIAIDDVTLKKGECPRKQMDPNKGARWEGGGGAESGGSCVWRGFLSVGGGCLCLNRGSE
CLSDGNHVALTV
Download sequence
Identical sequences ENSMMUP00000033757 9544.ENSMMUP00000033757 ENSMMUP00000033757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]