SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000033811 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000033811
Domain Number 1 Region: 9-89
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000000602
Family HLH, helix-loop-helix DNA-binding domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000033811   Gene: ENSMMUG00000010168   Transcript: ENSMMUT00000014196
Sequence length 650
Comment pep:known chromosome:MMUL_1:7:20159205:20186335:1 gene:ENSMMUG00000010168 transcript:ENSMMUT00000014196 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEAEAFAYYRRTHTANERRRRGEMRDLFEKLKITLGLLHSSKVSKSLILTRAFSEIQGLT
DQADKLIGQKNLLTRKRNILIRKVSSLSGKTEEVVLKKLEYIYAKQQALEAQKRKKKMGS
DEFDMSPRISKQQEGSSTSSVDLGQMFINNRRGKPLILSRKKDQATENTSPSNTPHTSAN
LVMTPQGQLLTLKGPLFSGPVVTVSPDLLESDLKPQVASSAVALPENDDLFMMPRIVNVT
SLATEGGLVDMGGSKYPHEVPDDKPSDHLKDTVRNEDNSLEDKSRISSRGNRDGRVMLGP
TQVFLANKDSVYPQIVDVSSMQKAQEFLPKKISGDMRGIQYKWKESESRGERVKSKESSF
HKLKMKDLKDSSIEMELRKVTSAIEEAALDSSELLTNMEDEDDTDETLTSLLNEIAFLNQ
QLNDDSVSLAELPSSMDTEFPGDARRAFISKVTSGNRAAFQVEHLGTGLKELPDVQGESD
SISPLLLHLEDDDFSENEKQLAEPASEPDVLKIVIDSEIKDSLLSNKKAIDGGKNTSGLL
AEPESVSSPPTLHMKTGLENSNSTDTLWRPMPKLAPLGLKVANPSSDADGQSLKVMPCLA
PIAAKVGSVGHKMNLTGNDPEGRESKVMPTLAPVVAKLGNSGASPSSAGK
Download sequence
Identical sequences ENSMMUP00000033811 9544.ENSMMUP00000033811 ENSMMUP00000033811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]