SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034092 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034092
Domain Number 1 Region: 152-214
Classification Level Classification E-value
Superfamily SH3-domain 5.51e-24
Family SH3-domain 0.000021
Further Details:      
 
Domain Number 2 Region: 2-72
Classification Level Classification E-value
Superfamily SH3-domain 4.59e-20
Family SH3-domain 0.0000329
Further Details:      
 
Domain Number 3 Region: 99-157
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000108
Family SH2 domain 0.0000337
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034092   Gene: ENSMMUG00000004756   Transcript: ENSMMUT00000041059
Sequence length 217
Comment pep:known chromosome:MMUL_1:16:70629517:70701620:-1 gene:ENSMMUG00000004756 transcript:ENSMMUT00000041059 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAELNGKDGFIPKNYIEMKPHPH
REGSVPGTRSEEACYSAVPEDLRFARLEPLAGPVLSVPPRFGNDVQHFKVLRDGAGKYFL
WVVKFNSLNELVDYHRSTSVSRNQQIFLRDIEQVPQQPTYVQALFDFDPQEDGELGFRRG
DFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV
Download sequence
Identical sequences ENSMMUP00000034092 9544.ENSMMUP00000034092 ENSMMUP00000034092

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]