SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034258 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034258
Domain Number 1 Region: 116-199,231-483,587-690
Classification Level Classification E-value
Superfamily MFS general substrate transporter 3.14e-26
Family Glycerol-3-phosphate transporter 0.048
Further Details:      
 
Domain Number 2 Region: 505-556
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.000000412
Family Ovomucoid domain III-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034258   Gene: ENSMMUG00000029885   Transcript: ENSMMUT00000041223
Sequence length 723
Comment pep:known chromosome:MMUL_1:6:98622831:98761462:-1 gene:ENSMMUG00000029885 transcript:ENSMMUT00000041223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEDVARRSEDQYEVPGRVEPREAARARPAKDWRARESLKSSKSSKSSKKVGKKYRYLRL
LPEALIRFGGFRKRKKDKSSVSKKPGELDDSSEQPCGLGCLVSPCCECCNNICCFMVFYC
ILVLCQGVVFGLTDVSIGNVQREYSLKTIEKLALELSYDISSGLVVMFIAFYGDRKKVTW
FVASSFLIGLGSLLCALPFINEEKNKSKVGIEDICTEIKVVSGCQSSDASFQSKYLYFIT
LGQTMQGIAGMPLYILGTTFIDENVATHSAGIYVGIAECMSMIGYGMGYVIGAPLVKVPE
NSTSATNTTGTNGSTEWLWTWWIRFLSAALIAWFTLIPLSCFPHNMPGSTRIKAAKRKQR
HWFDSKLKDLQVGTSIKDLCAVFWILMKNPVLICLSLSKATEYLVIIGAAEFLPIYLENQ
FMLTPPAATILAGLVLIPGGALGQLLGGIIASTLEMSCKALMRFIMATSVISLILLMFIT
LVRCNPLQFAGINEDYDGEGQLGNLTAPCNEKCRCSSSVYSSICGRDDIEYFSPCFAGCM
YSKALTRKKTYYNCSCIKEGLITADEEGDFIDARRGKCDAKCYKLPLFVAFIFSTLVFSG
FSGVPIALTIMRIVPVQLRSLALGVCYVVLRIFGTIPGPSIFKMSGENSCIFRDVNECGY
TGRCWIYNKTRMAYLFVGISFLCKLCTIIFTTTAFFMYKRQVNESTDIPNITVKNPKVKK
ERN
Download sequence
Identical sequences F7CCC4
ENSMMUP00000034256 9544.ENSMMUP00000034256 XP_001095830.1.72884 XP_014995980.1.72884 ENSMMUP00000034258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]