SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034364 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034364
Domain Number 1 Region: 1-117
Classification Level Classification E-value
Superfamily XRCC4, N-terminal domain 1.06e-53
Family XRCC4, N-terminal domain 0.000000552
Further Details:      
 
Domain Number 2 Region: 118-208
Classification Level Classification E-value
Superfamily XRCC4, C-terminal oligomerization domain 7.32e-32
Family XRCC4, C-terminal oligomerization domain 0.00000434
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034364   Gene: ENSMMUG00000021609   Transcript: ENSMMUT00000041335
Sequence length 336
Comment pep:known chromosome:MMUL_1:6:79248636:79540639:1 gene:ENSMMUG00000021609 transcript:ENSMMUT00000041335 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKISRIHLTSEPNIAHFLQVSWEKTLESGFVITLTDGHSAWTGTVSESEISQEADDMA
MEKGKYVDELRKALVSGAGPADVYTFNFSKESCYFFFEKNLKDVSFRLGSFNLEKVENPA
EVIRELICYCLDTIAENEAKNEHLQKENERLLRDWNDVQGRFEKCVNAKEALETDLYKRF
ILVLNEKKTKIRSLHNKLLNTAQEQEKDIKQEGETTICSEMTADRDPVYDESTDEENENQ
PDPSGSASAAVSKDDSIISSLDVIDIAPSRKRRQRMQKNLGTEPKMAPQEHQFQEKEKAL
PDSSLPETSKKEHISAENMSLETLRNSSPEDLFDEI
Download sequence
Identical sequences 9544.ENSMMUP00000034364 ENSMMUP00000034364 ENSMMUP00000034364

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]