SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034395 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034395
Domain Number 1 Region: 2619-2777
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.35e-33
Family SPRY domain 0.0014
Further Details:      
 
Domain Number 2 Region: 2423-2614
Classification Level Classification E-value
Superfamily Fibronectin type III 2.48e-22
Family Fibronectin type III 0.0037
Further Details:      
 
Domain Number 3 Region: 2227-2276
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.00000427
Family B-box zinc-binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000034395
Domain Number - Region: 2267-2381
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0303
Family BAR domain 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034395   Gene: ENSMMUG00000020733   Transcript: ENSMMUT00000041367
Sequence length 2788
Comment pep:known chromosome:MMUL_1:6:75958976:75984131:1 gene:ENSMMUG00000020733 transcript:ENSMMUT00000041367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALSKVRKEEIVPDSQEATAHVSQDQKMEPQPPNIPGFEMKYSVLPDVVGEPKKGVKPKL
VLNVTSELEQRKLSEKEPEVIKPCSPLKETSLSGPEVLSAAKMEMKHDSKITTTPTVLHS
ASSGVEKQVEHGPHALAFSALSEEIKKEMEPSSSTTTASVTKLDSNLTKVVKEEISTDSS
LVTPVGHPVLTKVGKGELGSGLPPLVTSTDEHSVLAEEDKVAIKGASPNETSSKHLAWSE
AEKEIKFDSPPSVSSIAEHSVLSEVEAKEVKAGLPVIKTSSSQYSDESEEARVEDKQGLS
CSTVRDSEHLVSSEKKSLVSTSEVLGPEHELSLSLWGEIKKEETELPSSQNVSPASKHII
PKGKDEEIASSSPELENSASGLAPTLLLLSDDKNKQAVEVSSTDQGDFPSEKQDIALAEL
SLEPEKKNKPHQLLELPNAGSEFASGLGRQSGSIGTKQAKSPVTETGDSVLEKGPAELRS
REGKEENRELYASATMPTTSELSSLLREESQNEEIKPFSPKIVSLELKEPPASVAEGDNP
EEFQPFTFSLKGLSEEVSHPADFKKGGNQEIGPLPPTGNLKAQVMGDIVAKLSEETGHPD
SSQLLQSVTEPSKIALSDLVEQKTEKALHSDQTIKLPDVSTSFADKQDLDIKQFSFMKEN
LPLEQSKSFMTTKPADVKETKMEEFFISPKDENWMLGKPENVASQHEERIAGSVQLDSSG
SNELRPEQLKAAVSSMDHIYEVRKQVLPHSAEESHLSSQEAVSALDTSSGNVETLSCKSY
SSEELKLAEEPKSFVLAGNVERNIAEKKESHSLMESESLLLEKANTEFSWPSKEDSQEKI
KLPPERFLQKPVSGLSVEQVKSETIPSSVKTTHFLAEGVEPALGNEKEAHRSTPPFSGEK
PLEESKMVQLKVIDDADEEKKPAPEVKIPTQRKPISSLHSKEPQSPESPEVTEKPPTQPK
VAKPDLPQEKGKKGISSFKSWMSSLFFGSSTPDRKVAEQEDLETLPSPSVEKAVTVIEPE
GTIPTNFNVAEKQADHSLSEVKLKTADESRGTLVKSGEGQNVKEKSIILSNVEDLQQPKS
ISEVSREDYGKKEISDNSEEVNINSVVTSADGEKHLEIQPYSLIGEKLIMEEAKTIVPLH
VTDNKRVQKPAIAPPSKWNISIFKEEPRSDQKEKSLLSFDVVDKVPQQPKSASSNFASKN
ITKESEKSESIILPVEESKGSLVDLSEDRLKKEMQNPTSLKISEEETKLRSVSPTETKDN
LENRSYTLAEKKVLAEKQDSVAPLELRDSNEIGKTQITHGSRSTELEESKANAMPQHFYQ
NEDYSERPKIIVGSEKEKGEEKENQVYVLSEEKKKQEHQPYSVNVAESMIKESNISLGHS
LGETQSFSLVKATSVTEKSDAVLSDAHPEIREAKAVATQPHPLEESKVLVEKTKTFLPAA
LPCRDEIENHSLSQEGNLVLEKSSRDMPDHREEKEQFRESELLKGGSVAITKESMKQGFP
TKESERTLAYPFDETKSSETPPYLLSSVKPQTLVSGASPEINAMKKQEMPQSELTPERHT
VHTIQTSKDDTFDVPKQSVLVSKHHLEAVEDTHVKEPLSSAKSNYAQFIYSASASNADKM
VSNKEMSKEPEDTYAKDEDFTVTSKPAGLSEDQKTAFSIISEGCEILNIHAPAFISSIDQ
EESEQMQDKLEYLEEKASFKTVPLRDDSETVACHKTLKSRLEDSDEKVTSLKESKQKETR
HTEEKTSTDSETDLSFIQSTIPSEEDYFEKYTLIDYNISPDPEKQKAPQKLNVEDKLSEE
VTEEATSFPGSSVESALEHEYDLVKLDESFYGPEKDHDILSHPETQKSLGIQKSADRNVS
KDVKRDVDSKSLGMPLFEAEEGVLSRTQIFPTTIKAINPELLEEPPALAFLYKDLYEEAV
GEKNKEEETASEGDSVNSEASFPSRNSDTDDGTGIYFEKYILKDDILHDTSLTQKDQGQG
LEEKRVGRDDSYQPIAAEGEIWGKFGTICREKSLEEQKGVYGEGESVGHVETLGNIAMQK
KAPIREDIRVATQKISYAVPFEDTHHVLEHADEAGSQGNEVENASPDVNLNVPVQVSFPE
EEFASGATHVQETPLEEPKILVPPEPSEERLRNSPVQDEYEFAESLHYEVLPQDILSEEL
SSESRPEDVLSQGKESFEHISENEFVSETEQSTSAEQKELGSEWKEENQLSSELVTEKAQ
KELKKSQIDTYCYTCKCPISATDKVFGIHKDHEVSTLDTAISAVKVQLAEFLENLQEKSL
RIEAFVSEIESFFNTIEENCSKNEKRLEEQNEEMMKKVLAQYDEKAQSFEEVKKKKMEFL
HEQMVHFLQSMDTAKDTLETIVREAEELDEAVFLTSFEEINERLLSAMESTASLEKMPAA
FSLFEHYDDSSARSDQMLKQVAVPQPPRLEPQEPNSATSTTIAVYWSMNKDDVIDSFQVY
CMEEPQDDQEVNELVEEYRLTVKESYCIFEDLEPDRCYQVWVMAVNFTGCSLPSERAIFR
TAPSTPVIRAEDCTVCWNTATIRWRPTTPEATETYTLEYCRQHSSEGEGLRSFSGIKGLQ
LKVNLQPNDNYFFYVRAINAFGTSEQSEAALISTRGTRFLLLRETAHPALHISSSGTVIS
FAERRRLTEIPSVLGEELPSCGQHYWETTVTDCPAYRLGICSSSAMRAGALGQGETSWYM
HCSEPQRYTFFYSGIVSDVHVTERPARVGILLDYSNQRLIFINAESGQLLFLIRHRFNEG
VHPAFALEKPGKCTLHLGIEPPDSVRHK
Download sequence
Identical sequences 9544.ENSMMUP00000027284 ENSMMUP00000034395 ENSMMUP00000027284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]