SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000034705 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000034705
Domain Number 1 Region: 658-721
Classification Level Classification E-value
Superfamily SH3-domain 3.02e-21
Family SH3-domain 0.00087
Further Details:      
 
Domain Number 2 Region: 556-636
Classification Level Classification E-value
Superfamily SH3-domain 8.93e-21
Family SH3-domain 0.00064
Further Details:      
 
Domain Number 3 Region: 725-785
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-20
Family SH3-domain 0.00069
Further Details:      
 
Domain Number 4 Region: 489-549
Classification Level Classification E-value
Superfamily SH3-domain 1.97e-18
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 5 Region: 396-483
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000984
Family SH3-domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000034705   Gene: ENSMMUG00000006026   Transcript: ENSMMUT00000041684
Sequence length 787
Comment pep:known chromosome:MMUL_1:5:143366483:143467949:-1 gene:ENSMMUG00000006026 transcript:ENSMMUT00000041684 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNTEQSQNSIVSRIKVFEGQANIETSGLPKKPEITPRSLPPKPTVSSGKPSVAPKPAASR
ASGEWDSGTENRLKVTSKEGLTPCPPLQEAGSLPVTKPELPKKPNPGLIRSVNPEIPGRG
PLAESSDSGKKVPTPAPRPLLLKKSVSSENPTDPSAPLKPVTVPPRLAGASQAKAYKSLG
EGPPANPPVPVLQSKPLGDIDLISFDDDVLPTPSGNLAEESVGSEMVLDPFQLPAKTEPM
KERAVQPAPTRKPTVIRIPAKPGKCLHEDPQSPPPLPAEKPIGNTFSTVSGKPSNVDRTK
NLESNHPGQTGGFVRGPPRLPPRPMNGKTIPTQQPPTKVPPERPPPPKLSATRRSNKKLP
FNRSSSDMDLQKKQSNLATGLSKAKSQVFKNQDPVLPPRPKPGHPLYSKYMLSVPHGIAS
EDIVSQNPGELSCKRGDVLVMLKQTENNYLECQKGEDTGRVHLSQMKIITPLDEHLRSRP
HDPSHAQKPVDSGAPHAVVLHDFPAEQVDDLNLTSGETVYLLEKIDTDWYRGNCRNQIGI
FPANYVKVIIDIPEGGNGKRESVSSHCVKGSRCVARFEYIGEQKDELSFSEGEIIILKEY
VNEEWARGEVRGRTGIFPLNFVEPVEDSPTSGANVLSTKVPLKTKKEDSGSNSQVNSLSA
EWCEALHSFTAETSDDLSFKRGDRIQILERLDSDWCRGRLQDREGIFPAVFVRPCPAEAK
SMSAIVPKGRKAKALYDFRGENEDELSFKAGDIITELESVDDDWMSGELMGKSGIFPKNY
IQFLQMS
Download sequence
Identical sequences 9544.ENSMMUP00000034705 ENSMMUP00000034705 ENSMMUP00000034705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]