SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035169 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035169
Domain Number 1 Region: 41-251
Classification Level Classification E-value
Superfamily LmbE-like 1.31e-39
Family LmbE-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035169   Gene: ENSMMUG00000030296   Transcript: ENSMMUT00000042170
Sequence length 254
Comment pep:known chromosome:MMUL_1:16:16134334:16245322:-1 gene:ENSMMUG00000030296 transcript:ENSMMUT00000042170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAMWFLCVAAAVVAWGFLWVWDSSERVKSREQGERLGAESRTLLAIAHPDDEAMFFAPT
VLGLARLRHWVYLLCFSAVAFFSKSWGQERLAYLLQKCVVWNCALISIVLLPCRDFPDDP
GVQWDTEHVASVLLQHIEVNGINLVVTFDAGGVSGHSNHIALYAAVRALHSEGKLPKGCS
VLTLQSVNVLRKYISLLDLPLSRLHTQDVLFVLNSKEVAQAKRAMSCHRSQLLWFRRLYI
LFSRYMRINSLSFL
Download sequence
Identical sequences ENSMMUP00000035169 ENSMMUP00000035169 9544.ENSMMUP00000035169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]