SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035472 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035472
Domain Number 1 Region: 204-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.53e-27
Family Classic zinc finger, C2H2 0.0025
Further Details:      
 
Domain Number 2 Region: 260-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.82e-26
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 3 Region: 316-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-25
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 4 Region: 41-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-21
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 373-420
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-20
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 6 Region: 169-218
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000599
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035472   Gene: ENSMMUG00000004021   Transcript: ENSMMUT00000005698
Sequence length 442
Comment pep:known chromosome:MMUL_1:3:47342585:47356259:-1 gene:ENSMMUG00000004021 transcript:ENSMMUT00000005698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQADLVSQEPQALLENVNKTHSSSFSNSQPSGEADQTHVLFQELVTFEDVAVYFIRKE
WKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDISQGL
KFKEAYEREVSLKRPLGNSPGERLTRKMQDFGQVTVEEKITPMGERSEKYNDFGNSFTVN
SNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQSSHLI
QHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLTHHQR
IHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQRIHTG
EKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTGEKPL
NGMGMSKSSLRVTTELNIREST
Download sequence
Identical sequences ENSMMUP00000007747 9544.ENSMMUP00000007747 ENSMMUP00000035472

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]