SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000035902 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000035902
Domain Number 1 Region: 108-492
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 6.05e-43
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000991
Further Details:      
 
Domain Number 2 Region: 469-580
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 2.75e-30
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000504
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000035902
Domain Number - Region: 51-98
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00537
Family Thioltransferase 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000035902   Gene: ENSMMUG00000012091   Transcript: ENSMMUT00000042892
Sequence length 584
Comment pep:known scaffold:MMUL_1:1099214740908:19039:75279:1 gene:ENSMMUG00000012091 transcript:ENSMMUT00000042892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQQVMLTCKGVTRGHAVPAGPGRKPRLRRSSRLAAGEKHLTRPALLLCHEYGRALEGTLS
ELAAETDLPVVFVKQRKIGGHGPTLKAYQEGRLQKLLKMNGPEDLPESYDYDLIIIGGGS
GGLAAAKARLLEAAQYGKKVMVLDFVTPTPLGTRWGLGGTCVNVGCIPKKLMHQAALLGQ
ALQDSRNYGWKVEETVKHDWDRMIEAVQNHIGSLNWGYRVALREKKVVYENAYGQFIGPH
RIKATNNKGKEKIYSAERFLIATGERPRYLGIPGDKEYCISSDDLFSLPYCPGKTLVVGA
SYVALECAGFLAGIGLDVTVMVRSILLRGFDQDMASKIGEHMEEHGIKFIRQFVPIKIEQ
IEAGTPGRLRVVAQSTNSEEIIEGEYNTVLLAIGRDACTRKIGLETVGVKINEKTGKIPV
TDEEQTNVPYIYAIGDILEDKVELTPVAIQAGRLLAQRLYAGSTVKCDYENVPTTVFTPL
EYGACGLSEEKAVEKFGEENIEVYHSYFWPLEWTIPSRDNNKCYAKIICNTKDNERVVGF
HVLGPNAGEVTQGFAAALKCGLTKKQLDSTIGIHPVCAEVASFI
Download sequence
Identical sequences 9544.ENSMMUP00000035902 ENSMMUP00000035902 ENSMMUP00000035902

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]