SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036177 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036177
Domain Number 1 Region: 100-162
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 5.42e-17
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 281-344
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.9e-16
Family LIM domain 0.001
Further Details:      
 
Domain Number 3 Region: 223-284
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 8.04e-16
Family LIM domain 0.0016
Further Details:      
 
Domain Number 4 Region: 187-221
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000387
Family LIM domain 0.00044
Further Details:      
 
Domain Number 5 Region: 63-97
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000171
Family LIM domain 0.00091
Further Details:      
 
Domain Number 6 Region: 158-189
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000101
Family LIM domain 0.0009
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036177
Domain Number - Region: 340-369
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0189
Family LIM domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036177   Gene: ENSMMUG00000009156   Transcript: ENSMMUT00000043165
Sequence length 387
Comment pep:known chromosome:MMUL_1:13:108373049:108468433:1 gene:ENSMMUG00000009156 transcript:ENSMMUT00000043165 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSGRARPCVIPENEEIPPAALNSVPEANGTEDERAVSKLQRRHSDVKVYKEFCDFYAK
FNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGRKY
CEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRHLC
RPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELKGE
LYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKGLA
YCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDMKP
VCKKCYEKFPLELKKRLKKLAETLGRK
Download sequence
Identical sequences F7HRP5 G7PMX1
XP_001082828.2.72884 XP_005575273.1.63531 ENSMMUP00000036177 ENSMMUP00000012005 9544.ENSMMUP00000012005

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]