SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036579 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036579
Domain Number 1 Region: 219-312
Classification Level Classification E-value
Superfamily Immunoglobulin 2.08e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 2 Region: 38-139
Classification Level Classification E-value
Superfamily Immunoglobulin 2.23e-17
Family I set domains 0.037
Further Details:      
 
Domain Number 3 Region: 127-208
Classification Level Classification E-value
Superfamily Immunoglobulin 5.14e-17
Family I set domains 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036579   Gene: ENSMMUG00000020198   Transcript: ENSMMUT00000043579
Sequence length 345
Comment pep:known chromosome:MMUL_1:14:130415422:130665187:-1 gene:ENSMMUG00000020198 transcript:ENSMMUT00000043579 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGVCGYLFLPWKCLVVVSLRLLFLVPTGVPVRSGDATFPKAMDNVTVRQGESATLRCTID
DRVTRVAWLNRSTILYAGNDKWSIDPRVIILVNTPTQYSIMIQNVDVYDEGPYTCSVQTD
NHPKTSRVHLIVQVPPQIMNISSDVTVNEGSSVTLLCLAIGRPEPTVTWRHLSVKEGQGF
VSEDEYLEISDIKRDQSGEYECSALNDVAAPDVRKVKITVNYPPYISKAKNTGVSVGQKG
ILSCEASAVPMAEFQWFKEDTRLATGLDGVRIENKGRMSTLTFFNVSEKDYGNYTCVATN
KLGNTNASITLYGPGAVIDGVNSASRALACLWLSGTLLAHFFIKF
Download sequence
Identical sequences A0A2I3ME37 A0A2K5P1C9 A0A2K6ANU4 F6WLQ2 G7PPV6
ENSMMUP00000026594 ENSMMUP00000036579 XP_005580251.1.63531 XP_011730140.1.29376 XP_014971633.1.72884 9544.ENSMMUP00000026594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]