SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036808 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036808
Domain Number 1 Region: 770-959
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.38e-56
Family Nucleotide and nucleoside kinases 0.0000000918
Further Details:      
 
Domain Number 2 Region: 501-599
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-32
Family PDZ domain 0.000077
Further Details:      
 
Domain Number 3 Region: 603-717,764-798
Classification Level Classification E-value
Superfamily SH3-domain 5.91e-31
Family SH3-domain 0.0000716
Further Details:      
 
Domain Number 4 Region: 174-277
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-30
Family PDZ domain 0.000041
Further Details:      
 
Domain Number 5 Region: 281-375
Classification Level Classification E-value
Superfamily PDZ domain-like 5.39e-27
Family PDZ domain 0.0000259
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000036808
Domain Number - Region: 69-110
Classification Level Classification E-value
Superfamily Pheromone ER-23 0.00863
Family Pheromone ER-23 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036808   Gene: ENSMMUG00000007921   Transcript: ENSMMUT00000043823
Sequence length 962
Comment pep:known chromosome:MMUL_1:14:81727319:83572307:-1 gene:ENSMMUG00000007921 transcript:ENSMMUT00000043823 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIQEFYEVTLLNSQKSCEQKIEEANQVLQKWEKTSLLAPCHDRLQKSSELTDCSGPKENA
SYIEQNKENQCFENETDETTTQNQGRCPAQNCSVEAPAWMPVHHCTKYRYQDEDAPHDHS
LPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNTDTLDTIPYVN
GTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAAAEDGRLRVND
CILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFKGPKGLGFSIA
GGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTHEEAVAILKNT
SEVVYLKVGKPTTIYMTDPYGPPDITHSYSPPMENHLLSGNNGTLEYKTSLPPISPGRYS
PIPKHMLVDDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSAPYSHYHLGLLP
DSEMTSHSQHSTTTRQPSVTLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGIFVSF
ILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPEDYARF
EAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKYGDIL
HVINASDDEWWQARRVMLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDSKGSF
NDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDLILSYEPVTRQEINYTRPVIILGP
MKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKFIEAG
QYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPRSLEPLMEMN
KRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWIPSKE
KL
Download sequence
Identical sequences ENSMMUP00000036808 9544.ENSMMUP00000036808 ENSMMUP00000036808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]