SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000036909 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000036909
Domain Number 1 Region: 92-131
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000385
Family EGF-type module 0.011
Further Details:      
 
Domain Number 2 Region: 16-93
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000222
Family Laminin G-like module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000036909   Gene: ENSMMUG00000030992   Transcript: ENSMMUT00000043913
Sequence length 132
Comment pep:known chromosome:MMUL_1:10:90430256:90433005:-1 gene:ENSMMUG00000030992 transcript:ENSMMUT00000043913 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PNIGHLGLPHGPSGEKMAVVTVDDCDTTMAVRFGKDVGNYSCAAQGTQTGSKKSLDLTGP
LLLGGVPNLPEDFPVHNRQFVGCMRNLSVDGCAARRNFCDGRRCQNGGTCVNRWNMYLCE
CPLRFGGKNCEQ
Download sequence
Identical sequences G7PFZ2
9544.ENSMMUP00000036909 ENSMMUP00000036909 ENSMMUP00000036909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]