SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037022 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037022
Domain Number 1 Region: 513-656
Classification Level Classification E-value
Superfamily Clathrin adaptor appendage domain 7.32e-51
Family gamma-adaptin C-terminal appendage domain-like 0.000000115
Further Details:      
 
Domain Number 2 Region: 10-171
Classification Level Classification E-value
Superfamily ENTH/VHS domain 3.36e-42
Family VHS domain 0.000000216
Further Details:      
 
Domain Number 3 Region: 189-317
Classification Level Classification E-value
Superfamily GAT-like domain 3.92e-41
Family GAT domain 0.000000362
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037022   Gene: ENSMMUG00000003853   Transcript: ENSMMUT00000044018
Sequence length 656
Comment pep:known chromosome:MMUL_1:10:81520675:81547369:1 gene:ENSMMUG00000003853 transcript:ENSMMUT00000044018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPAMEPETLEARINRATNPLNKELDWASINGFCEQLNEDFEGPPLATRLLAHKIQSPQE
WEAIQALTVRRGETTIRPRPSWTTRVLETCMKSCGKRFHDEVGKFRFLNELIKVVSPKYL
GSRTSEKVKNKILELLYSWTVGLPEEVKIAEAYQMLKKQGIVKSDPKLPDDTTFPLPPPR
PKNVIFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRMEKISKRVNAIEEVNN
NVKLLTEMVMSHSQGGTAAGSSEDLMKELYQRCERMRPTLFRLASDTEDNDEALAEILQA
NDNLTQVINLYKQLVRGEEVNGDATAGSIPGSTSALLDLSGLDLPPAATTYPAMPTRPGE
QASPKQPSASVSLLDDELMSLGLSDPTPPSGLSLDGTGWNSFQSSDATEPPAPALAQAPS
MESRPPAQTSLPASSGLDDLDLLGKTLLQQSLPPESQQVRWEKQQPAPRLTLRDLQNKSS
SCSSPSSSATSLLHTVSPEPPKPPQQPIPTELSLASITVPLESIKPSDILPVTVYDQHGF
RVLFHFARDPLPGRSDVLVVVVSMLSTAPQPIRNIVFQSAVPKVMKVKLQPPSGTELPAF
NPIVHPSAITQVLLLANPQKEKVRLRYKLTFTMGDQTYNEMGDVDQFPAPETWGSL
Download sequence
Identical sequences 9544.ENSMMUP00000005134 ENSMMUP00000037022 ENSMMUP00000005134

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]