SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037362 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037362
Domain Number 1 Region: 575-741
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.43e-41
Family SPRY domain 0.014
Further Details:      
 
Domain Number 2 Region: 295-356
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 2.14e-16
Family B-box zinc-binding domain 0.0013
Further Details:      
 
Domain Number 3 Region: 511-604
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000148
Family Fibronectin type III 0.0015
Further Details:      
 
Domain Number 4 Region: 2-38
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000788
Family RING finger domain, C3HC4 0.053
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000037362
Domain Number - Region: 206-240
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00251
Family TFIIH p44 subunit cysteine-rich domain 0.058
Further Details:      
 
Domain Number - Region: 145-172
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0837
Family Cytochrome c3-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037362   Gene: ENSMMUG00000017449   Transcript: ENSMMUT00000044346
Sequence length 745
Comment pep:known chromosome:MMUL_1:1:225735100:225796472:-1 gene:ENSMMUG00000017449 transcript:ENSMMUT00000044346 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEELKCPVCGSLFREPIILPCSHNVCLPCARTIAVQTPDGEQHLPQPLLLSRGSGLQAG
AAATPTLEHDAAAGPACSGAGGSAAGGLGGGAGGGGDHADKLSLYSETDSGYGSYTPSLK
SPNGVRVLPMVPAPPGSSAAAARGAACSSLSSSSSSITCPQCHRSASLDHRGLRGFQRNR
LLEAIVQRYQQGRGAVPGASAAAAVAICQLCDRTPPEPAATLCEQCDVLYCAACQLKCHP
SRGPFAKHRLVQPPPPPAPAEAASGPTGAAQGAPSGGSGCKSPGGAGAGATGGSTARKFP
TCPEHEMENYSMYCVSCRTPVCYLCLEEGRHAKHEVKPLGAMWKQHKAQLSQALNGVSDK
AKEAKEFLVQLKNILQQIQENGLDYEACLVAQCDALVDALTRQKAKLLTKVTKEREHKLK
VVWDQINHCTLKLRQSTGLMEYCLEVIKENDPSGFLQISDALIKRVQVSQEQWVKGALEP
KVSAEFDLTLDSEPLLQAIHQLDFIQMKCRVPPVPLLQLEKCCTRNNSVIRAWRMPPFTH
SPVDGYILELDDGAGGQFREVYVGKETLCTIDGLHFNSTYNARVKAFNSSGVGPYSKTVV
LQTSDVAWFTFDPNSGHRDIILSNDNQTATCSSYDDRVVLGTAAFSKGVHYWELHVDRYD
NHPDPAFGVARASVVKDMMLGKDDKAWAMYVDNNRSWFMHCNSHTNRTEGGVCKGATVGV
LLDLNKHTLTFFINGQQQGPTAFSH
Download sequence
Identical sequences ENSMMUP00000037360 9544.ENSMMUP00000037360 ENSMMUP00000037362

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]