SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037533 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037533
Domain Number 1 Region: 4-36,86-143
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.45e-16
Family Voltage-gated potassium channels 0.0065
Further Details:      
 
Domain Number 2 Region: 163-259
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000000000432
Family Voltage-gated potassium channels 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037533   Gene: ENSMMUG00000007402   Transcript: ENSMMUT00000044521
Sequence length 306
Comment pep:known chromosome:MMUL_1:14:8826660:8829613:1 gene:ENSMMUG00000007402 transcript:ENSMMUT00000044521 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCLRPWARYGLLVVAHLLTLGLGAVLFQALEGPPACRLRAELRAELAAFQAEHRACLPP
GALEELVGTALATQAHGVSSLGNSSEARNWDLPSVLLFTASILTTTGYGHMAPLSPGGKA
FCMVYAALGLPASLALVATLRHCLLPALSRPGAWVVHWQLSPARAALLQAVALGLLVAGS
FVLLPALVLWGLQGDCSLLGAIYFCFSSLSTIGLGDLLPGHGRSLHPVIYHLGQLALLGY
LLLGLLAMLLAVETFSELPQVRAMGKFFRPSSPVTAENQGGILGQDELALSTLPPAAPTS
GQAPAC
Download sequence
Identical sequences ENSMMUP00000037533 ENSMMUP00000037533 9544.ENSMMUP00000037533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]