SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000037664 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000037664
Domain Number 1 Region: 53-105
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000103
Family Lectin leg-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000037664   Gene: ENSMMUG00000031227   Transcript: ENSMMUT00000044641
Sequence length 117
Comment pep:known scaffold:MMUL_1:1099214728459:5274:5784:-1 gene:ENSMMUG00000031227 transcript:ENSMMUT00000044641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAEGWIWRWGWGRRCLGRPGLPGPGPGPTTPLFLLLLLGSVAADITDGNSEHLKREHSL
IKPYQGVGSSSMPLWDFQGSTMLTSQYVRLTPDERSKEGSIWNHQVSGSQEDRLTVR
Download sequence
Identical sequences ENSMMUP00000037664 9544.ENSMMUP00000037664 ENSMMUP00000037664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]