SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038002 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038002
Domain Number 1 Region: 82-146
Classification Level Classification E-value
Superfamily BPTI-like 1.38e-17
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0045
Further Details:      
 
Domain Number 2 Region: 40-89
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000262
Family Elafin-like 0.0022
Further Details:      
 
Domain Number 3 Region: 148-192
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000068
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 4 Region: 193-241
Classification Level Classification E-value
Superfamily Elafin-like 0.000000366
Family Elafin-like 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038002   Gene: ENSMMUG00000003805   Transcript: ENSMMUT00000044988
Sequence length 243
Comment pep:known chromosome:MMUL_1:10:18873750:18892468:1 gene:ENSMMUG00000003805 transcript:ENSMMUT00000044988 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AWIVTEGMHLPLYSSTFSWRNVAFLLLLSLALEWTSALLHKKNKQKPGLCPKERLACTAE
LPNSCNTDFDCQEYLKCCLFACQKKCMDPFQEPCTLPVRQGNCNHDAQRWYFDFKNYRCT
PFTYRGCKGNANNFLSENDCRTACMLVVKDGQCPLFPVTGRKECPPSCHSDIDCPQTDKC
CESRCGFVCARAWTAHKVKQGFCPRKPLLCAQIDKPRCLQDDECPLVEKCCSLCGLKCTD
PKH
Download sequence
Identical sequences F7HTE2
ENSMMUP00000005069 9544.ENSMMUP00000005069 ENSMMUP00000038002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]