SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038111 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000038111
Domain Number - Region: 74-140
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0445
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038111   Gene: ENSMMUG00000031371   Transcript: ENSMMUT00000045094
Sequence length 209
Comment pep:known chromosome:MMUL_1:1:166618251:166620288:1 gene:ENSMMUG00000031371 transcript:ENSMMUT00000045094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NSCFGESEIKAPPPSLNDCIGMVDGRAESTDKKISRLDTELVKCKDQIKMRGGPAKNTVT
QKALRVLKQKRMYEQQQENRTQQSFNTEQVNYTIQSLKDTKTTADAMKLGAGEMKAYNDQ
IENLQDQVVDMMEDANEIQEALSRSYGGPEFNEDDLEAELDLGDELVADKDSYLDEAVSA
PAIPTQKTNDGVLVDEFGLPQIPASYICI
Download sequence
Identical sequences ENSMMUP00000038110 9544.ENSMMUP00000038110 ENSMMUP00000038111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]