SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000038387 from Macaca mulatta 69_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000038387
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Histone-fold 5.84e-48
Family Nucleosome core histones 0.00000287
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000038387   Gene: ENSMMUG00000031473   Transcript: ENSMMUT00000019709
Sequence length 131
Comment pep:known scaffold:MMUL_1:1099214374536:9329:9782:1 gene:ENSMMUG00000031473 transcript:ENSMMUT00000019709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSGRGKQGGKARAKAKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLT
AEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK
TESHHHKAQSK
Download sequence
Identical sequences A0A096N4E6 A0A2K5KHQ2 A0A2K5XIK9 A0A2K6AML0 A0A2K6JPD5 A0A2K6NFN3 G1SAM3 G7MQV3 G7P4K8 H2PI41
9544.ENSMMUP00000038387 9600.ENSPPYP00000018219 ENSNLEP00000022567 ENSNLEP00000022567 NP_001180728.1.72884 XP_002816539.1.23681 XP_003263279.1.23891 XP_010357834.1.97406 XP_010363389.1.97406 XP_011741038.1.29376 XP_011821873.1.47321 XP_011886902.1.92194 XP_015305302.1.63531 XP_017733983.1.44346 ENSPPYP00000018219 ENSPANP00000007259 ENSPPYP00000018219 ENSMMUP00000038387 ENSMMUP00000038387

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]